BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0473 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 23 6.3 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 6.3 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 568 TNLSVPVQSVSVASLYGRFTFHEFALCELET 476 TN+ + +QSV+V ++ T F C L T Sbjct: 289 TNVGISLQSVTVVVMFFLATAETFLYCLLGT 319 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.4 bits (48), Expect = 6.3 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 287 YCALQNRLKRNKPCFKMASERPCFFDDISLANDSDNI-KLMTLAGKHL 147 YCA + KM +E FD+++ + + NI K+ T+ K++ Sbjct: 512 YCAANTDPEGAMKIVKMLNELYTIFDELTDSKSNSNIYKVETVGDKYM 559 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,862 Number of Sequences: 2352 Number of extensions: 10850 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -