BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0473 (651 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28742-3|AAA68333.3| 837|Caenorhabditis elegans Hypothetical pr... 28 6.6 DQ407523-1|ABD85015.1| 856|Caenorhabditis elegans OGA-1c protein. 28 6.6 DQ407522-1|ABD85014.1| 854|Caenorhabditis elegans OGA-1b protein. 28 6.6 DQ407521-1|ABD85013.1| 870|Caenorhabditis elegans OGA-1d protein. 28 6.6 Z48334-5|CAA88312.1| 424|Caenorhabditis elegans Hypothetical pr... 27 8.7 >U28742-3|AAA68333.3| 837|Caenorhabditis elegans Hypothetical protein T20B5.3 protein. Length = 837 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 639 IMHQRARREAVLNIIPYICIGHVERILVCQ 550 ++H+RA A NIIP++C G E +C+ Sbjct: 640 LLHRRATNFADRNIIPFLCSG-AEHNFLCE 668 >DQ407523-1|ABD85015.1| 856|Caenorhabditis elegans OGA-1c protein. Length = 856 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 639 IMHQRARREAVLNIIPYICIGHVERILVCQ 550 ++H+RA A NIIP++C G E +C+ Sbjct: 657 LLHRRATNFADRNIIPFLCSG-AEHNFLCE 685 >DQ407522-1|ABD85014.1| 854|Caenorhabditis elegans OGA-1b protein. Length = 854 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 639 IMHQRARREAVLNIIPYICIGHVERILVCQ 550 ++H+RA A NIIP++C G E +C+ Sbjct: 657 LLHRRATNFADRNIIPFLCSG-AEHNFLCE 685 >DQ407521-1|ABD85013.1| 870|Caenorhabditis elegans OGA-1d protein. Length = 870 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 639 IMHQRARREAVLNIIPYICIGHVERILVCQ 550 ++H+RA A NIIP++C G E +C+ Sbjct: 673 LLHRRATNFADRNIIPFLCSG-AEHNFLCE 701 >Z48334-5|CAA88312.1| 424|Caenorhabditis elegans Hypothetical protein F10B5.5 protein. Length = 424 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 142 DTKCFPAKVINLILSLSLAREMSSKKHGRSDAI 240 D KC +I+ + SL + RE SS + SDAI Sbjct: 242 DEKCMVFVLIDEVESLGMCRESSSSRSEPSDAI 274 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,716,815 Number of Sequences: 27780 Number of extensions: 236994 Number of successful extensions: 433 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -