BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0472 (711 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81517-4|CAB04211.1| 350|Caenorhabditis elegans Hypothetical pr... 30 1.4 U28971-5|AAA68379.1| 982|Caenorhabditis elegans Hypothetical pr... 29 4.3 >Z81517-4|CAB04211.1| 350|Caenorhabditis elegans Hypothetical protein F28B1.4 protein. Length = 350 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 53 ISNQDALVAASENEDRCECFQVIYYREILI 142 +S +A NE CEC ++I YR+++I Sbjct: 257 LSENSLYIALQSNEGACECPKIIPYRDVVI 286 >U28971-5|AAA68379.1| 982|Caenorhabditis elegans Hypothetical protein B0244.6 protein. Length = 982 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -2 Query: 233 TRSLTASLIRRQR-RTSFSILKFCTL*QKKG-KLIFLCNILPENIRTCLRFRK 81 T S +AS ++R R R +SI+ C + + +FL ++ P +I TC F K Sbjct: 464 TLSSSASSVKRVRNRLGWSIIAVCLIAAAQIIPYVFLLDVAPHDIETCKGFYK 516 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,268,388 Number of Sequences: 27780 Number of extensions: 317673 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -