BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0472 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23160.1 68415.m02767 F-box family protein contains Pfam PF00... 28 5.3 At2g03930.2 68415.m00359 hypothetical protein 28 5.3 >At2g23160.1 68415.m02767 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 395 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 Query: 209 IRRQRRTSFSILKFCTL*QKKGKLIFLCNILPENIRTCLRFRKRQPVHLD 60 IR ++ F I +FC L KGKL + N ++CL +RK+ V D Sbjct: 241 IRSEKFIFFEIERFCRLINYKGKLAVIYFEDDVNYQSCL-YRKKNYVEPD 289 >At2g03930.2 68415.m00359 hypothetical protein Length = 164 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = +1 Query: 328 LNYKYSYLINKIKLQ-IHFYKL 390 +N KY YL+ KIK+Q I F+K+ Sbjct: 140 INLKYQYLLTKIKIQNIKFHKI 161 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,700,696 Number of Sequences: 28952 Number of extensions: 269413 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -