BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0468 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.3 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 25 2.3 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 4.1 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 24 5.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 9.4 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 358 DILALLRAYRPRSINPLDEV-PSKLRAVVVNGQH 456 D+L L YRP NP V SK AVV G++ Sbjct: 88 DVLVLSHTYRPPENNPRWAVDASKKVAVVATGRY 121 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 28 PDTVQQYPETVANARXQRSGRSDPLLRSEETP*PE 132 P T Q+ PE+V + + GRS L+S + P P+ Sbjct: 391 PTTSQENPESVTDEEIRNIGRS---LKSRKVPGPD 422 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 472 GRHLTFPGNCRYDWRTTTSIE 534 G+ L+ PG+C D+R T IE Sbjct: 950 GQSLSGPGSCLEDFRATPFIE 970 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 479 TSPSQETVATIGARPRR*KLHAANPTSNGNPSSYLEV 589 T+P+ T T RPRR +A + N P Y V Sbjct: 324 TTPATTTTTTTTPRPRRYPTNAGHKVMNA-PKEYYPV 359 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 9.4 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 450 STHLHVRRSPPHLPRKLSLRLAHDHVDRNFTLLIQLQTETQA 575 ++HL R+PP L R++ R+ D + + + TET + Sbjct: 384 TSHLRGSRTPPELDREVLERIVTDLFPDHNSFDWPMPTETSS 425 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,206 Number of Sequences: 2352 Number of extensions: 11749 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -