BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0467 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29060.1 68415.m03532 scarecrow transcription factor family p... 29 2.8 At1g07000.1 68414.m00745 exocyst subunit EXO70 family protein si... 29 2.8 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 28 4.9 At3g63330.1 68416.m07125 protein kinase family protein contains ... 28 6.5 At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 28 6.5 >At2g29060.1 68415.m03532 scarecrow transcription factor family protein Length = 1336 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 393 LAFTLSDNGGVAYGDSKDXTSSRVSWKFIPLWENNKSTS 509 LA +S GG +Y S TSS W F L ENN+ +S Sbjct: 116 LAQLVSSPGGSSYASSTTTTSSDSQWSFDCL-ENNRPSS 153 >At1g07000.1 68414.m00745 exocyst subunit EXO70 family protein similar to leucine zipper protein GI:10177020 from [Arabidopsis thaliana] contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 599 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 150 VIVKMLRQDFVEGCAFVGVQRRREETQDNNSGLHLR 43 + V+M+ F + C+ V RRRE +++ S LHLR Sbjct: 192 IAVRMVAGGFAKECSRVYSSRRREFLEESLSRLHLR 227 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/66 (21%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 46 KMKSAVVVLCLFAASLYAD-EGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNKGEL 222 K K+ +LC+ +++ + + +++ ++++ DYD+ V+ S LI + + Sbjct: 398 KGKTFQFLLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQDSLM 457 Query: 223 ITNVVN 240 +TN V+ Sbjct: 458 LTNGVD 463 >At3g63330.1 68416.m07125 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 376 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = +1 Query: 133 EHLYNDVIIADYDSAVERSKLIYTDNKGELITNVV-----NNLIRKTR*TAWSTPTSSG 294 E YND+ + + V SKL+YT + E+ + ++R ++ W T SG Sbjct: 65 ESRYNDIWLVFHHEGVSLSKLMYTVEEAEISSEKAEEASHGQILRPSKWWTWLKTTESG 123 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 181 ERSKLIYTDNKGELITNVVNN 243 E+SK IYT+ + LI NVV N Sbjct: 790 EKSKAIYTELRSNLIRNVVRN 810 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,984,437 Number of Sequences: 28952 Number of extensions: 236521 Number of successful extensions: 552 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -