BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0464 (741 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC530.02 |||membrane transporter|Schizosaccharomyces pombe|chr... 25 8.6 SPBC1348.10c |||phospholipase |Schizosaccharomyces pombe|chr 2||... 25 8.6 SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 25 8.6 SPAC977.09c |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 25 8.6 >SPBC530.02 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 541 Score = 25.4 bits (53), Expect = 8.6 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -2 Query: 128 IGHNIVLG*RAADSLTPVN--HYQIVVSNRDAVVFPEDRV 15 IG IVL A + TP+ HY V + R+ V+ PEDR+ Sbjct: 374 IGIGIVL----AGACTPIIYVHYNRVYTRRNGVMSPEDRL 409 >SPBC1348.10c |||phospholipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +3 Query: 39 GITVTDDNLVVIDWRKGVRRSLSQNDVMSYFMEDV 143 G + T N ++DW + V+++ + D++ +ED+ Sbjct: 354 GTSATLFNSFLLDWNENVKKNDTYYDILHAILEDL 388 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 25.4 bits (53), Expect = 8.6 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 27 WKYY-GITVTDDNLVVIDWR 83 W Y GI V DD + + DWR Sbjct: 317 WNYLSGIAVLDDRIAMHDWR 336 >SPAC977.09c |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 673 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +3 Query: 39 GITVTDDNLVVIDWRKGVRRSLSQNDVMSYFMEDV 143 G + T N ++DW + V+++ + D++ +ED+ Sbjct: 354 GTSATLFNSFLLDWNENVKKNDTYYDILHAILEDL 388 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,668,355 Number of Sequences: 5004 Number of extensions: 48735 Number of successful extensions: 109 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -