BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0463 (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 30 0.89 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 30 0.89 At1g76965.1 68414.m08961 glycine-rich protein 30 0.89 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 194 STRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLQILSTRGSSP 48 ST+PGTG ++ D+PR S ++ K +++ D P L I T G+SP Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLHI--TPGASP 415 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 194 STRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLQILSTRGSSP 48 ST+PGTG ++ D+PR S ++ K +++ D P L I T G+SP Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLHI--TPGASP 415 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 30.3 bits (65), Expect = 0.89 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 185 PGTGXIRFPSKPDTPRSSEPILIPKLRIQFAD 90 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,485,689 Number of Sequences: 28952 Number of extensions: 216592 Number of successful extensions: 551 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -