BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0456 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 5.2 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 5.2 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 24 5.2 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 24 5.2 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 24 5.2 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 24 5.2 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 24 5.2 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 24 5.2 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 5.2 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 5.2 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 5.2 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 5.2 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 5.2 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 5.2 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 5.2 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 24 5.2 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 24 5.2 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 5.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.2 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 6.9 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 6.9 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 40 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 71 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 40 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 71 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 42 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 73 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 42 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 73 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 45 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 76 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 45 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 76 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 57 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 88 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 57 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 88 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 39 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 70 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 39 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 70 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 177 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 268 SIEEIE-VDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGV 387 + E+I+ + + ++ K+ G HTD Y+ S K G+ Sbjct: 2253 TFEQIQGISQESSTDIWHKLVDAGYLHTDCYSTSAKKCHGL 2293 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 268 SIEEIE-VDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGV 387 + E+I+ + + ++ K+ G HTD Y+ S K G+ Sbjct: 2254 TFEQIQGISQESSTDIWHKLVDAGYLHTDCYSTSAKKCHGL 2294 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 414 AFMSQYYRKHSLRIFSGECIRVSMADSG 331 A +++Y R H+L +F G +R + SG Sbjct: 238 AVVNEYSRLHNLNMFDGVELRNTTRQSG 265 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 414 AFMSQYYRKHSLRIFSGECIRVSMADSG 331 A +++Y R H+L +F G +R + SG Sbjct: 214 AVVNEYSRLHNLNMFDGVELRNTTRQSG 241 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,642 Number of Sequences: 2352 Number of extensions: 13724 Number of successful extensions: 87 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -