BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0455 (730 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41552-3|AAC69100.2| 303|Caenorhabditis elegans Dauer or aging ... 70 2e-12 Z50741-1|CAA90609.1| 395|Caenorhabditis elegans Hypothetical pr... 30 1.5 AF039049-11|AAB94246.1| 499|Caenorhabditis elegans Cytochrome p... 30 1.5 U50197-4|AAA91257.1| 443|Caenorhabditis elegans Intermediate fi... 28 5.9 >U41552-3|AAC69100.2| 303|Caenorhabditis elegans Dauer or aging adult overexpressionprotein 3 protein. Length = 303 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/76 (44%), Positives = 50/76 (65%) Frame = +2 Query: 23 MAQIISGIEVAGSIENDLRQQVTRLRSKWSGFEPRLAIVQVGGREDSNVYIRMKLKAAEK 202 +A+I+SG+E + + +D+ Q++ + R F LAIVQVG R DSNVYI KLK A++ Sbjct: 2 VAEIVSGLEYSKKVLHDVGQKIAKTREHHPNFHAVLAIVQVGNRSDSNVYINSKLKKAKE 61 Query: 203 IGIAAEHIRLPRDITE 250 IG + I+LP IT+ Sbjct: 62 IGADGKLIKLPDTITQ 77 Score = 55.6 bits (128), Expect = 3e-08 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = +1 Query: 256 LLAKITSLNESPSVHGIIVQMPLDSDHAIDAHRVTDAVSPDKDVDGLNTIN 408 L +I +LN + GII+Q+PLD H IDA V D + P KDVDGL IN Sbjct: 80 LKREIMALNHDNEIDGIIIQLPLDCKHEIDADSVIDLIDPLKDVDGLTRIN 130 >Z50741-1|CAA90609.1| 395|Caenorhabditis elegans Hypothetical protein F55G7.1 protein. Length = 395 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 127 PGLEARPF*TQPRHLLTQVIFYRSCNFNPRYNLCH 23 P PF +QP+H+ F++S N N ++LC+ Sbjct: 57 PNFRRVPFSSQPQHVSNAQSFHQSPNSNDSFSLCY 91 >AF039049-11|AAB94246.1| 499|Caenorhabditis elegans Cytochrome p450 family protein 35B2 protein. Length = 499 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -2 Query: 387 NIFIRRDSISDSMSVDRVVRIKGHLNNDAVNGRRFVQTRDF 265 NI + RDS+ + + + R + ++ DAVNG+ VQT DF Sbjct: 134 NIGVGRDSMEERILEELDARCE-EIDADAVNGKTVVQTSDF 173 >U50197-4|AAA91257.1| 443|Caenorhabditis elegans Intermediate filament, d protein 2 protein. Length = 443 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 20 KMAQIISGIEVAGSIENDLRQQVTRLRSKWSGFEPRLA 133 K+ +I G E SI+N R+++ R+RS + F +L+ Sbjct: 288 KITEIKKGSESYSSIQNQAREEILRIRSIVNEFRGKLS 325 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,644,014 Number of Sequences: 27780 Number of extensions: 305607 Number of successful extensions: 778 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -