BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0455 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 3.9 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 23 3.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.0 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 162 ESSRPPTCTMASLGSKPDHFER 97 +SS P +S + PDH+ER Sbjct: 27 DSSGIPHSAESSASNSPDHYER 48 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -3 Query: 551 TPETTMRLRPSTTTFASYSDAGLLNQFHAPGRSARNESGQITY 423 T ++ M + P+T A Y + NQ+ R R + I+Y Sbjct: 80 TLKSKMEIDPATQKDAGYYECQADNQYAVDRRGFRTDYVMISY 122 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 507 KCGSARAESHRGLRCQSC 560 + GSA SHRG+ + C Sbjct: 1706 RMGSAEGLSHRGMEDEIC 1723 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,350 Number of Sequences: 438 Number of extensions: 3443 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -