BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0454 (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 4.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 4.1 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 5.4 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 5.4 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 9.5 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 356 RARGYYGPTPTDWEDQEY 409 RA GYYGP + QEY Sbjct: 92 RAAGYYGP-QQQMDGQEY 108 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 605 VLSSESLVQLALVVFRTIFFRGVTXIFTTLTF 510 VLS +V L+VF F +G+T L + Sbjct: 128 VLSKNGIVFAGLIVFILFFAQGLTSPIFNLVY 159 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 406 IRFGCSS*SIGFFIFTDSFRRTSGA 480 +RFGC S + ++ TD +++ A Sbjct: 269 LRFGCLSTRLFYYQLTDLYKKIKKA 293 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 47 SGCISSHHRSSFCRRTKKKDSHPLTAEGKAYSSS*EDLHN 166 SG ++ HH S PL+ Y+SS H+ Sbjct: 18 SGSVAGHHHEQSAAAAAAYRSFPLSLGMSPYASSQHHHHH 57 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 582 YEXLTREDSVSFLTIYLIDGXHRNKNTDENMRAW 683 +E +T +++ + + ++G + N D ++R W Sbjct: 217 WESVTGQNAPLYASSIDVEGSQKLLNVDASIRGW 250 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,633 Number of Sequences: 336 Number of extensions: 3363 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -