BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0454 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31A2.03 |mrpl11||mitochondrial ribosomal protein subunit L11... 28 1.5 SPCC1682.13 |||SWIRM domain protein|Schizosaccharomyces pombe|ch... 25 7.8 >SPAC31A2.03 |mrpl11||mitochondrial ribosomal protein subunit L11|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 27.9 bits (59), Expect = 1.5 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Frame = -1 Query: 467 LRKLSVNMKNPML-----HEEQPNRIPDLPSPLVWVHNSLLRDKEAKALK 333 +R S+ +KNP L H I + P+ L+ HN+LL +EAK+L+ Sbjct: 7 VRASSIYVKNPQLRKSFLHSNYVQLIQESPNFLILQHNNLL-PREAKSLR 55 >SPCC1682.13 |||SWIRM domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 272 Score = 25.4 bits (53), Expect = 7.8 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 290 YEESPTRTPGTSVTASKLLPLYRARGYYGPTPTDWEDQEY-DLVAPHEASDSSYL 451 +EE P P SV ++ P + GP P D D Y DL+ P E +S L Sbjct: 160 FEELPNFCPDMSVLDNRTHPRTLKAEWKGP-PLDLSDDPYRDLLHPAELHLASTL 213 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,684,609 Number of Sequences: 5004 Number of extensions: 54630 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -