BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0454 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1691 - 35393728-35394585 31 0.86 01_06_1654 - 38924090-38924101,38924183-38924215,38924737-389248... 31 0.86 04_03_0904 + 20717005-20718087 29 2.6 02_05_1147 - 34447519-34448042,34448126-34449092,34449458-344496... 29 4.6 01_07_0082 - 40965947-40967023 29 4.6 12_02_1005 + 25235757-25235915,25236258-25236374,25236467-252365... 28 6.0 05_06_0014 + 24854462-24854570,24854958-24855065,24855240-248554... 28 6.0 02_05_0460 - 29224525-29224620,29225525-29226625 28 6.0 04_04_1433 + 33564153-33564435,33564501-33564728,33564834-335654... 28 8.0 03_06_0759 - 36059872-36059928,36059934-36060125,36060241-360603... 28 8.0 03_02_0869 - 11944309-11945004,11945522-11945838,11945933-11946098 28 8.0 01_07_0138 - 41383304-41384458 28 8.0 >04_04_1691 - 35393728-35394585 Length = 285 Score = 31.1 bits (67), Expect = 0.86 Identities = 24/64 (37%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = +2 Query: 338 KLLPLYRARGYYGPTPTDWEDQEYDLVAPHEASDSS--YLPTAFAEPPGPSIVP--HNHA 505 K L YR R G TDW EY LVA H+ D S + AF +P ++ H H Sbjct: 119 KTLVFYRGRAPNG-CKTDWIIHEYRLVAHHQQPDGSCWVVCRAFHKPTTTTLQHQLHLHR 177 Query: 506 PRKL 517 P L Sbjct: 178 PAPL 181 >01_06_1654 - 38924090-38924101,38924183-38924215,38924737-38924829, 38924909-38924965,38925048-38925143,38925237-38925304, 38925429-38925486,38925572-38925658,38925935-38925982, 38926060-38926116,38926200-38926458,38926666-38926858, 38926991-38927098,38927849-38927957 Length = 425 Score = 31.1 bits (67), Expect = 0.86 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 4/72 (5%) Frame = +2 Query: 269 PLNSVEIYEESPTRTPGTSVTASKLLPLYRARGYYGPTPTDWEDQEY----DLVAPHEAS 436 P S I ++ R G+ T +LP + + + P DW+D+EY D V P E Sbjct: 186 PDASYSILVDNRERESGSMYTDWDILPPRKIKDVHAKKPKDWDDREYIEDPDAVKP-EGY 244 Query: 437 DSSYLPTAFAEP 472 DS +P +P Sbjct: 245 DS--IPKEIPDP 254 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = +2 Query: 299 SPTRTPGTSVTASKLLPLYRARGYYGPTPTDWEDQEYDLVAPHEASDSSYLPTAFAEPPG 478 +PT TP T P Y+ + PTPT ++ Q +P+ + PT P Sbjct: 284 TPTPTPYTPTPKPNPPPTYKPQPKPTPTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTP 343 Query: 479 P 481 P Sbjct: 344 P 344 >02_05_1147 - 34447519-34448042,34448126-34449092,34449458-34449657, 34449867-34450051,34450130-34450228,34450316-34450357, 34450516-34450860,34450956-34451101,34451213-34451296, 34451424-34451502,34451596-34451675,34451824-34451875, 34451992-34452026 Length = 945 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 174 PSSQYAPAYMPSAKGAVAVPTNIALPA*PASYP*T 278 PS AP+Y+PS A PTN+ P+ P P T Sbjct: 658 PSQNGAPSYIPSQASQFAAPTNLQ-PSQPTFPPQT 691 >01_07_0082 - 40965947-40967023 Length = 358 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 189 APAYMPSAKGAVAVPTNIALPA*PASYP 272 APAY PSA A A P P P +YP Sbjct: 157 APAYPPSAAAAAAYPPQSTYPP-PTAYP 183 >12_02_1005 + 25235757-25235915,25236258-25236374,25236467-25236535, 25237509-25237964 Length = 266 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 213 WHLACMPAHTVRTGGWLCKSSYDDEYALPSA 121 W + H V GGWL + DD A P A Sbjct: 4 WLYPIVGGHQVAAGGWLSPEAGDDRRAAPPA 34 >05_06_0014 + 24854462-24854570,24854958-24855065,24855240-24855432, 24855892-24856150,24856236-24856292,24856370-24856417, 24856725-24856811,24856885-24856942,24857084-24857151, 24857279-24857374,24857483-24857539,24857906-24857952, 24858184-24858210,24858312-24858504 Length = 468 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 269 PLNSVEIYEESPTRTPGTSVTASKLLPLYRARGYYGPTPTDWEDQEYDLVAPHEASDSSY 448 P S + ++ R G+ T +LP + + P DW+D+EY + P E Y Sbjct: 186 PDASYSLLVDNREREFGSMYTDWDILPPRKIKESNAKKPKDWDDREY-IEDPDEVKPEGY 244 Query: 449 --LPTAFAEP 472 +P +P Sbjct: 245 DSIPKEIPDP 254 >02_05_0460 - 29224525-29224620,29225525-29226625 Length = 398 Score = 28.3 bits (60), Expect = 6.0 Identities = 26/85 (30%), Positives = 35/85 (41%) Frame = +2 Query: 251 CIASIVPLNSVEIYEESPTRTPGTSVTASKLLPLYRARGYYGPTPTDWEDQEYDLVAPHE 430 C AS + + SP+ TP T +S+L+PL A + P AP Sbjct: 223 CPASASASAAAGLVSLSPSATP-TGANSSRLMPLLLAPPHMQKRPPVLPVSPAS--APAA 279 Query: 431 ASDSSYLPTAFAEPPGPSIVPHNHA 505 ++SS PP PS PH HA Sbjct: 280 LAESS--SEELRPPPLPSSHPHAHA 302 >04_04_1433 + 33564153-33564435,33564501-33564728,33564834-33565453, 33566938-33567195 Length = 462 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 208 LGMYAGAYCEDGWLVM 161 LG + AYC +GWL+M Sbjct: 412 LGYWRSAYCREGWLLM 427 >03_06_0759 - 36059872-36059928,36059934-36060125,36060241-36060348, 36060440-36060712,36060923-36061009,36061085-36061276, 36061841-36061969,36062087-36062200,36062446-36062490, 36062785-36062956,36063229-36063515,36063989-36064456 Length = 707 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 344 LPLYRARGYYGPTPTDWEDQEYDLVAPHEASDSSYLPTAFAEPPGPS 484 LP AR DW D + D + AS S+ LPT P P+ Sbjct: 8 LPARPARPISFEDSPDWADDDVDSIHLATASASASLPTTAYPSPSPT 54 >03_02_0869 - 11944309-11945004,11945522-11945838,11945933-11946098 Length = 392 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 323 SVTASKLLPLYRARGYYGPTPTDWEDQEYDLVAPHEASDSSYLPTAF 463 SV K L Y+ R G T T+W EY L A + ++Y P F Sbjct: 110 SVGVKKALVFYKGRPPKG-TKTNWIMHEYRLAAADAHAANTYRPMKF 155 >01_07_0138 - 41383304-41384458 Length = 384 Score = 27.9 bits (59), Expect = 8.0 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 7/82 (8%) Frame = -3 Query: 333 AVTDVPGVRVGDSSYISTEFRGTMLAMQAGRC**ALLQRPWH-------LACMPAHTVRT 175 AV+ G R G SS++ E G + C + R +H P++ + Sbjct: 283 AVSRYDGEREGTSSWLPVEDLGEAAILVGSSCSLCVSTRGFHDDLRNRLFFAWPSY--ES 340 Query: 174 GGWLCKSSYDDEYALPSAVSGC 109 G + C + DEY LP+A GC Sbjct: 341 GKYYC--FHPDEYRLPTATPGC 360 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,643,492 Number of Sequences: 37544 Number of extensions: 370309 Number of successful extensions: 1096 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1096 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -