BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0454 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 >SB_26826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 162 ITNHPSSQYAPAYMPSAKGAVAVPTN----IALPA*PASY 269 +T HPS+ AP Y+PSA P+ + LP+ P++Y Sbjct: 121 LTEHPSTYRAPLYLPSAPLLTERPSTYRAPLYLPSAPSTY 160 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +2 Query: 245 PAC-IASIVPLNSVEIYEESPTRTPGTSVTASKLLPLYRARGYYGPTPTDWEDQEYDLVA 421 P+C A+ PLNS +PT TP TS +S + + G + + T + D+ +A Sbjct: 940 PSCQSATATPLNSYHSSLVNPTTTPITSYQSSSNV----SAGSHHSSLTSFTDRACSPMA 995 Query: 422 PHEASDSSYLP 454 E S S+ +P Sbjct: 996 VEEESQSACVP 1006 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,513,532 Number of Sequences: 59808 Number of extensions: 423826 Number of successful extensions: 968 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 965 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -