BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0454 (686 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058279-1|AAL13508.1| 1148|Drosophila melanogaster GH03118p pro... 30 3.4 AE013599-3458|AAF46895.4| 2964|Drosophila melanogaster CG30092-P... 30 3.4 >AY058279-1|AAL13508.1| 1148|Drosophila melanogaster GH03118p protein. Length = 1148 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 216 PWHLACMPAHTVR-TGGWLCKSSYDDEYALPSAV 118 PWH++C+ ++ V GGW +D LP+ + Sbjct: 746 PWHISCVESNKVTPVGGWGTLVDHDGRLILPARI 779 >AE013599-3458|AAF46895.4| 2964|Drosophila melanogaster CG30092-PD, isoform D protein. Length = 2964 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 216 PWHLACMPAHTVR-TGGWLCKSSYDDEYALPSAV 118 PWH++C+ ++ V GGW +D LP+ + Sbjct: 2562 PWHISCVESNKVTPVGGWGTLVDHDGRLILPARI 2595 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,504,310 Number of Sequences: 53049 Number of extensions: 624734 Number of successful extensions: 2035 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2035 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -