BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0453 (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22179-14|CAI06052.1| 443|Caenorhabditis elegans Hypothetical p... 31 0.92 U53333-5|AAA96158.2| 1852|Caenorhabditis elegans Amanitin resist... 29 2.8 M29235-1|AAA28126.1| 1859|Caenorhabditis elegans protein ( C.ele... 29 2.8 AF077540-8|AAC26310.2| 683|Caenorhabditis elegans Btb and math ... 28 6.5 >Z22179-14|CAI06052.1| 443|Caenorhabditis elegans Hypothetical protein F58A4.14 protein. Length = 443 Score = 30.7 bits (66), Expect = 0.92 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 286 RHLTFPGNCRYVLA-HDHVIETSRC*SNFKTENPRLLFWKIRAXYH 420 R+ G C ++L H +E S +NP++ +W RA YH Sbjct: 124 RYFYETGRCNFLLGRHQIAVEQLTKASEVMKDNPKVWYWLARAIYH 169 >U53333-5|AAA96158.2| 1852|Caenorhabditis elegans Amanitin resistant protein 1 protein. Length = 1852 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/57 (40%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = -1 Query: 553 KDHEPYNEPTPFCCLLTESEH----ILFDDRESFGSSVQNSLSIFFQFDDXPLLSSK 395 K H EPTP L E+ IL D R+ GSS Q SLS F F + SK Sbjct: 709 KAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSK 765 >M29235-1|AAA28126.1| 1859|Caenorhabditis elegans protein ( C.elegans RNA polymeraseII largest subunit (ama-1 IV) gene, complete cds. ). Length = 1859 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/57 (40%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = -1 Query: 553 KDHEPYNEPTPFCCLLTESEH----ILFDDRESFGSSVQNSLSIFFQFDDXPLLSSK 395 K H EPTP L E+ IL D R+ GSS Q SLS F F + SK Sbjct: 709 KAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSK 765 >AF077540-8|AAC26310.2| 683|Caenorhabditis elegans Btb and math domain containingprotein 47 protein. Length = 683 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +2 Query: 344 KLHAANPTSKRKTQGSYFGR*ERXIIELKENGQAILNGASKGFPIIEKDVFAFRQ--QAT 517 +LH + SK + + +I +NG L + G IEK + ++ Q Sbjct: 447 RLHVSLCCSKSNVTSEFRILADFELIIAGKNGGRPLKSKTNGCFNIEKTKNSSQELGQDV 506 Query: 518 EWCWLIVRFMVFAHLNLSVHIEVT 589 EW ++ +MV L + H+ +T Sbjct: 507 EWSTIVYDYMVDGRLTVEAHVNIT 530 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,637,744 Number of Sequences: 27780 Number of extensions: 308322 Number of successful extensions: 831 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -