BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0451 (701 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 24 1.0 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 24 1.0 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 1.8 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.4 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 9.7 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 24.2 bits (50), Expect = 1.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 236 LDKLKAGVSVGITIDIALWKFETSKYYVTII 328 L KLK + +G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 24.2 bits (50), Expect = 1.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 236 LDKLKAGVSVGITIDIALWKFETSKYYVTII 328 L KLK + +G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 584 HQKLVQPLCVSCHFDAR 634 H +LV PLC SC R Sbjct: 205 HAELVMPLCKSCDLHHR 221 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 255 PAFSLSNTQAYLKDPLPISWASFSNFS 175 P SLS A L +SW S S+ S Sbjct: 359 PLTSLSLASAQTLSELDLSWNSISSLS 385 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 343 QRFHQEHDHRNLS 381 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,553 Number of Sequences: 336 Number of extensions: 3573 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -