BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0450 (670 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0091 + 19967390-19969825 29 2.5 05_04_0204 - 19022329-19023990 29 3.3 >11_06_0091 + 19967390-19969825 Length = 811 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = -3 Query: 311 SIWSSLVWTKVSPRGSMPHLYISMNCLTTSTFMYLSQLFSML 186 +++S + ++ G + HL ++ NCL+ + YLS L SM+ Sbjct: 539 NMFSGNIPVSITKLGRLSHLDLACNCLSGTIPQYLSNLTSMM 580 >05_04_0204 - 19022329-19023990 Length = 553 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 190 IEKSCDKYMNVDVVKQFMEMYKWGMLPRGETF 285 + K CD++ + VVK F +M K G+ P TF Sbjct: 355 MRKLCDEHRWLSVVKLFTDMAKKGIAPNSWTF 386 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,150,746 Number of Sequences: 37544 Number of extensions: 301791 Number of successful extensions: 727 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -