BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0449 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 1.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.4 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.8 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.8 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 224 WSDK-LPQCVRSARSTVMLASSTNVCSPMVTXVPDPAAPW 340 +SDK + V+S+ V + N PMV + AA W Sbjct: 316 FSDKQIASVVKSSELAVRIQRQENNIRPMVKQIDTVAAEW 355 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 47 PSASGGCVLPQYPAHGSYVVLNTPNATPGQTFD 145 PSASGG +P+ P V L+ + G+ D Sbjct: 1357 PSASGGRPVPERPERVPTVDLSPSPSDRGRNDD 1389 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -1 Query: 237 SLSDHHPFKQKTSFLPITPYP 175 + + + PF T F+P+ P P Sbjct: 216 TFAQNGPFNTTTIFVPVKPCP 236 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 441 RGHMHSRFVQKRYKRDRTDXS 503 R MHS ++K+Y T+ S Sbjct: 330 RSDMHSDNIEKKYPPSETEQS 350 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 441 RGHMHSRFVQKRYKRDRTDXS 503 R MHS ++K+Y T+ S Sbjct: 330 RSDMHSDNIEKKYPPSETEQS 350 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,733 Number of Sequences: 438 Number of extensions: 3346 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -