BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0447 (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49364| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0089) 27 9.6 SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) 27 9.6 >SB_49364| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0089) Length = 828 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 361 LALTLRDDSNNDGXLAYGDGKD 426 + + L DD NNDG Y DG D Sbjct: 691 MMIMLNDDDNNDGNGVYVDGGD 712 >SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) Length = 776 Score = 27.1 bits (57), Expect = 9.6 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +2 Query: 47 FVASLYANETSVSDSKLEDDLYNSILVADYDNAVEKSKQIYEDKKSEVIT 196 F ASL A + S SDS EDDL ++ + D+ K++ + + +K + T Sbjct: 548 FRASLAAQQDSTSDSSSEDDL----IMDEKDHPQGKARSLSDKQKCKNTT 593 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,820,749 Number of Sequences: 59808 Number of extensions: 226994 Number of successful extensions: 709 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -