BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0446 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 102 2e-22 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 102 3e-22 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 102 3e-22 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 102 3e-22 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 101 7e-22 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 100 9e-22 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 100 9e-22 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 99 2e-21 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 98 7e-21 12_02_1282 + 27528159-27529148,27529549-27529614 70 2e-12 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 47 2e-05 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 45 5e-05 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 44 1e-04 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 41 8e-04 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 41 8e-04 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 37 0.013 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 34 0.092 11_03_0057 + 9375083-9375088,9375904-9376031,9376107-9376166,937... 29 3.5 08_02_0238 + 14665813-14668798,14669088-14669125 29 3.5 05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263,245... 28 8.0 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 28 8.0 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 102 bits (245), Expect = 2e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 294 DLYGNVVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 345 Score = 64.9 bits (151), Expect = 6e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 347 ILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 280 TYNSIMKCDVDIRK 293 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 102 bits (244), Expect = 3e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 294 DLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 345 Score = 64.9 bits (151), Expect = 6e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 347 ILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 280 TYNSIMKCDVDIRK 293 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 102 bits (244), Expect = 3e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 291 DLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 342 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 344 ILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 277 TYNSIMKCDVDIRK 290 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 102 bits (244), Expect = 3e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 294 DLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 345 Score = 64.5 bits (150), Expect = 8e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 347 ILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 280 TYNSIMKCDVDIRK 293 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 101 bits (241), Expect = 7e-22 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 297 DLYGNVVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 348 Score = 64.5 bits (150), Expect = 8e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 350 ILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 283 TYNSIMKCDVDIRK 296 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 100 bits (240), Expect = 9e-22 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 294 DLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 345 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 323 QMWISKQEYDESGPSIVHRKCF 258 QMWISK EYDESGP+IVHRKCF Sbjct: 370 QMWISKGEYDESGPAIVHRKCF 391 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 280 TYNSIMKCDVDIRK 293 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 100 bits (240), Expect = 9e-22 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGG Sbjct: 294 DLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG 345 Score = 61.7 bits (143), Expect = 5e-10 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWIS+ EY+ESGP+IVHRKCF Sbjct: 347 ILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 280 TYNSIMKCDVDIRK 293 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 99 bits (238), Expect = 2e-21 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGG+TM+PGIADRM KEIT+LAPS+MK+K+IAPPERKYSVWIGG Sbjct: 293 DLYGNVVLSGGSTMFPGIADRMSKEITSLAPSSMKVKVIAPPERKYSVWIGG 344 Score = 61.3 bits (142), Expect = 7e-10 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 346 ILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 552 ATYNSIMKCDVXIRK 508 ATYNSIMKCDV IRK Sbjct: 278 ATYNSIMKCDVDIRK 292 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 97.9 bits (233), Expect = 7e-21 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 DLY N VLSGG+TM+PGI DRM KEITALAP +MKIK++APPERKYSVWIGG Sbjct: 293 DLYGNVVLSGGSTMFPGIGDRMSKEITALAPGSMKIKVVAPPERKYSVWIGG 344 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 350 IXASLSTFQQMWISKQEYDESGPSIVHRKCF 258 I ASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 346 ILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 552 ATYNSIMKCDVXIRK 508 ATYNSIMKCDV IRK Sbjct: 278 ATYNSIMKCDVDIRK 292 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 70.1 bits (164), Expect = 2e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI 395 DLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK+ Sbjct: 294 DLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKM 331 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = -2 Query: 368 RMDRWIIXASLSTFQ-QMWISKQEYDESGPSIVHRKCF 258 RM + I + S+ + +MWI+K EYDESGPSIVHRKCF Sbjct: 314 RMSKEITALAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 549 TYNSIMKCDVXIRK 508 TYNSIMKCDV IRK Sbjct: 280 TYNSIMKCDVDIRK 293 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = -3 Query: 505 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 353 L+ +L+GG+T++P +R++KE+ L P ++KIIA + W GG Sbjct: 346 LFERIILTGGSTLFPRFTERLEKELRPLVPDDYQVKIIAQEDPILGAWRGG 396 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = -3 Query: 502 YANTVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIG 356 Y VLSGG++ PG+++R++KE+ L P+ + I++I PP S W G Sbjct: 398 YKTVVLSGGSSCLPGLSERLEKELRELLPAHISEGIRVIPPPFGTDSAWFG 448 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 11/62 (17%) Frame = -3 Query: 505 LYANTVLSGGTTMYPGIADRMQKEI------TALAPS-----TMKIKIIAPPERKYSVWI 359 LY + VLSGG+TMYPG+ R++KE+ L + ++++I PP RK+ V++ Sbjct: 323 LYQHIVLSGGSTMYPGLPSRLEKEMLDRYLDVVLKGNKDGLKKLRLRIEDPPRRKHMVYL 382 Query: 358 GG 353 GG Sbjct: 383 GG 384 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/55 (32%), Positives = 36/55 (65%), Gaps = 3/55 (5%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGG 353 +L ++ +LSGG++ + +R++KE+ + ++K++A ER++SVWIGG Sbjct: 397 ELLSSILLSGGSSSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGG 451 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = -2 Query: 368 RMDRWI---IXASLSTFQQMWISKQE 300 R WI I ASL +FQQMW SK + Sbjct: 444 RFSVWIGGSILASLGSFQQMWFSKAD 469 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 41.1 bits (92), Expect = 8e-04 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = -2 Query: 380 EEVLRMDRWIIXASLSTF---QQMWISKQEYDESGPSIVHRKCF 258 E + R W+ A L+ Q ++K +YDE+GPSIVH+KCF Sbjct: 355 ENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 6/57 (10%) Frame = -3 Query: 505 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE------RKYSVWIGG 353 L NT+L GGT G DR Q+E L+ S + ++ PPE +YS W+GG Sbjct: 311 LLENTMLCGGTASMTGFEDRFQREAN-LSASAICPSLVKPPEYMPENLARYSAWLGG 366 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 14/66 (21%) Frame = -3 Query: 508 DLYANTVLSGGTTMYPGIADRMQKEITALAP--------------STMKIKIIAPPERKY 371 DLY N VLSGG+TM+ R+Q +I + +++ ++A P + Y Sbjct: 338 DLYKNIVLSGGSTMFKDFHKRLQNDIKKIVDERVAATNARHHVEVKPVEVNVVAHPIQSY 397 Query: 370 SVWIGG 353 + W GG Sbjct: 398 AAWFGG 403 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 34.3 bits (75), Expect = 0.092 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 16/67 (23%) Frame = -3 Query: 505 LYANTVLSGGTTMYPGIADRMQKEITALAPS----------------TMKIKIIAPPERK 374 LY N VLSGG+TM+ R+Q+++ + + +++ +++ P ++ Sbjct: 370 LYKNIVLSGGSTMFKDFHRRLQRDLKKIVDARVLASNARLGGDAKAQPIEVNVVSHPIQR 429 Query: 373 YSVWIGG 353 Y+VW GG Sbjct: 430 YAVWFGG 436 >11_03_0057 + 9375083-9375088,9375904-9376031,9376107-9376166, 9376832-9376892,9377434-9377583,9377667-9377822, 9377905-9378116,9378572-9378673,9378785-9378924, 9379781-9379932 Length = 388 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -3 Query: 541 LHHEVRRXHP*DL--YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 368 ++ ++ HP L Y S G MYP D +K+ L K APPER+++ Sbjct: 230 IYRDILEYHPNMLREYLEGTESAGF-MYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQHN 288 >08_02_0238 + 14665813-14668798,14669088-14669125 Length = 1007 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 353 STDPYGVLPLWRSNDLNLHCRW-GESC 430 S DP G L W+ ND CRW G +C Sbjct: 62 SNDPGGFLGSWKQNDSIGFCRWPGVTC 88 >05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263, 2455287-2455436,2455526-2455681,2455775-2455986, 2456306-2456407,2456517-2456653,2456769-2457055 Length = 527 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 469 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 368 MYP D +K+ L K APPER+++ Sbjct: 350 MYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQHN 383 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = -3 Query: 505 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIG 356 L + +++GG ++ PG+ R++ I P +K++ + W G Sbjct: 622 LCQSILVTGGCSLIPGMIPRLESGIRQFRPYLSPLKLVRAADPLIDAWRG 671 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,047,875 Number of Sequences: 37544 Number of extensions: 341775 Number of successful extensions: 867 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -