BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0444 (482 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 23 1.5 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 1.5 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 1.5 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 4.5 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 206 YVQELEAALLRDKEAGPKPVPNH 274 Y+Q L+ E GPK PNH Sbjct: 189 YIQHGYLELVIPPENGPKMTPNH 211 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 206 YVQELEAALLRDKEAGPKPVPNH 274 Y+Q L+ E GPK PNH Sbjct: 189 YIQHGYLELVIPPENGPKMTPNH 211 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 206 YVQELEAALLRDKEAGPKPVPNH 274 Y+Q L+ E GPK PNH Sbjct: 189 YIQHGYLELVIPPENGPKMTPNH 211 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 149 PVRVQGAHTSGPGQ*CXRFYVQELEAALLRD 241 PVR+ G H G C + E AL D Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIALNND 226 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,248 Number of Sequences: 336 Number of extensions: 2144 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -