BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0443 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit ... 27 2.0 SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo... 27 3.5 SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces... 26 4.7 SPCC1223.08c |dfr1||dihydrofolate reductase Dfr1|Schizosaccharom... 26 4.7 SPCC11E10.09c ||SPCC188.01c|alpha-amylase homolog |Schizosacchar... 26 4.7 SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po... 25 8.1 >SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit Sfc4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 27.5 bits (58), Expect = 2.0 Identities = 24/107 (22%), Positives = 45/107 (42%) Frame = +3 Query: 159 RRWTLWHRRHPRGFVYPLDLFLYWRHREIKRSLIIDPELDVDKSGFRNFTSLRSKHPDVK 338 R++T+W + + LD+ +E S ++ L + F S+++ P K Sbjct: 580 RQFTIWKTEETQRRFHKLDILRQSLKKEENVSESLNEWLAIASELIDEFVSIKAFFPSEK 639 Query: 339 FMVAVGGWAEGGSKYSHMVAQKSTRMSFIRSVVDFLKKYDFDGLDLD 479 A G ++Y+ + Q + S I + D L + + LDLD Sbjct: 640 KARARAGLLTRRTRYASLNDQLT---SMINRLNDSLTRTKYGDLDLD 683 >SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 26.6 bits (56), Expect = 3.5 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = -3 Query: 211 SGYTN-PRGCLRCHNVQRRVGTPPNY*SNKRCALCCPTELMRRNSPGQPTSQISLAFST- 38 SGY + R C RCH+ ++++ N+ + R C + +R S S F Sbjct: 92 SGYDSYHRECFRCHDCRKQI-IDSNFKRDNRTIFCNDCKQVRHPSRSSDESADYHNFEVD 150 Query: 37 VTVRPCSXRA 8 VT++P ++ Sbjct: 151 VTIKPTETKS 160 >SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 360 WAEGGSKYSHMVAQKSTRMSFIRS-VVDFLKKYDFDGLDLD 479 W + G + + + S S++ + KYDFDGL +D Sbjct: 189 WQDSGVLLADLDVESSDVSSYLSDHFKSLISKYDFDGLRID 229 >SPCC1223.08c |dfr1||dihydrofolate reductase Dfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 461 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 321 KHPDVKFMVAVGGWAEGGSKYSHMVAQKSTRMS 419 +HP KF+V VGG+ ++ H K T S Sbjct: 136 QHPPFKFVVFVGGFRAEKPEFDHFYNPKLTTPS 168 >SPCC11E10.09c ||SPCC188.01c|alpha-amylase homolog |Schizosaccharomyces pombe|chr 3|||Manual Length = 478 Score = 26.2 bits (55), Expect = 4.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 399 QKSTRMSFIRSVVDFLKKYDFDGLDLD 479 + R F V D +K+Y FDG+ LD Sbjct: 190 KNEVRKFFQNWVSDLIKRYQFDGIRLD 216 >SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces pombe|chr 1|||Manual Length = 949 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 473 IQTVEVIFLQEVDNASD 423 + TVE+ LQE++NASD Sbjct: 223 LDTVELHLLQEIENASD 239 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,916,974 Number of Sequences: 5004 Number of extensions: 61538 Number of successful extensions: 171 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -