BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0433 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 38 0.010 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 37 0.017 SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) 36 0.022 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 36 0.029 SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) 36 0.039 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 35 0.051 SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.051 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 35 0.068 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 35 0.068 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_12156| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 35 0.068 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 34 0.090 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 34 0.090 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 34 0.090 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 34 0.090 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 34 0.090 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10) 34 0.090 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 34 0.12 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) 33 0.16 SB_47449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 33 0.21 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 33 0.21 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 33 0.21 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 33 0.21 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_25775| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 33 0.27 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.27 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.27 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 33 0.27 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 33 0.27 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_50958| Best HMM Match : Hc1 (HMM E-Value=3.7) 33 0.27 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 33 0.27 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 33 0.27 SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 33 0.27 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.27 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 33 0.27 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 33 0.27 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 33 0.27 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_2194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 32 0.36 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 32 0.36 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 32 0.36 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 32 0.36 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.36 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 32 0.36 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 32 0.36 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.36 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 32 0.36 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 32 0.36 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 32 0.36 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.36 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 32 0.36 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 32 0.36 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 32 0.36 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 32 0.36 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 32 0.36 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 32 0.36 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 32 0.36 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 32 0.36 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 32 0.36 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 32 0.36 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 32 0.36 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 32 0.36 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.36 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 32 0.36 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 32 0.36 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 32 0.36 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 32 0.36 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.36 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 32 0.36 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 32 0.36 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 32 0.36 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.36 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 32 0.36 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 32 0.36 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 32 0.36 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 32 0.36 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58763| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 32 0.36 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 32 0.36 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 32 0.36 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 32 0.36 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 32 0.36 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 32 0.36 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL +NPGDPLVLERPPP Sbjct: 574 VLRIAINPGDPLVLERPPP 592 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 +W + L+ +PGDPLVLERPPP Sbjct: 14 EWKLELSNSCSPGDPLVLERPPP 36 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 36.7 bits (81), Expect = 0.017 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VLA ++ PGDPLVLERPPP Sbjct: 849 VLAYILPPGDPLVLERPPP 867 >SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) Length = 187 Score = 36.3 bits (80), Expect = 0.022 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L L NPGDPLVLERPPP Sbjct: 64 LHALANPGDPLVLERPPP 81 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 DW ++ +PGDPLVLERPPP Sbjct: 179 DWTRRVSNSCSPGDPLVLERPPP 201 >SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 VNPGDPLVLERPPP Sbjct: 4 VNPGDPLVLERPPP 17 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A++L+ +PGDPLVLERPPP Sbjct: 4 AILLSNSCSPGDPLVLERPPP 24 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W L+ +PGDPLVLERPPP Sbjct: 6 WCYELSNSCSPGDPLVLERPPP 27 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 VNPGDPLVLERPPP Sbjct: 695 VNPGDPLVLERPPP 708 >SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) Length = 720 Score = 35.5 bits (78), Expect = 0.039 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 +NPGDPLVLERPPP Sbjct: 600 INPGDPLVLERPPP 613 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 35.1 bits (77), Expect = 0.051 Identities = 15/23 (65%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -1 Query: 68 WAVV-LAXLVNPGDPLVLERPPP 3 W +V + NPGDPLVLERPPP Sbjct: 80 WRLVEIIEKANPGDPLVLERPPP 102 >SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 35.1 bits (77), Expect = 0.051 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 L++PGDPLVLERPPP Sbjct: 158 LISPGDPLVLERPPP 172 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 AV NPGDPLVLERPPP Sbjct: 175 AVTNQLSANPGDPLVLERPPP 195 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W L+ +PGDPLVLERPPP Sbjct: 20 WTDRLSNSCSPGDPLVLERPPP 41 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V LA PGDPLVLERPPP Sbjct: 57 VQLAARAGPGDPLVLERPPP 76 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 + NPGDPLVLERPPP Sbjct: 219 VANPGDPLVLERPPP 233 >SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) Length = 156 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W + NPGDPLVLERPPP Sbjct: 28 WVPDIYLYNNPGDPLVLERPPP 49 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V++ +PGDPLVLERPPP Sbjct: 13 IVISNSCSPGDPLVLERPPP 32 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 VV++ +PGDPLVLERPPP Sbjct: 6 VVVSNSCSPGDPLVLERPPP 25 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+++ +PGDPLVLERPPP Sbjct: 4 VIISNSCSPGDPLVLERPPP 23 >SB_12156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 ++ V+PGDPLVLERPPP Sbjct: 91 IVETFVSPGDPLVLERPPP 109 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 AV ++ +PGDPLVLERPPP Sbjct: 190 AVAVSNSCSPGDPLVLERPPP 210 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V++ +PGDPLVLERPPP Sbjct: 24 IVISNSCSPGDPLVLERPPP 43 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 52 NPGDPLVLERPPP 64 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W + PGDPLVLERPPP Sbjct: 49 WRTCHGARITPGDPLVLERPPP 70 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 159 NPGDPLVLERPPP 171 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 AXLVNPGDPLVLERPPP 3 A L +PGDPLVLERPPP Sbjct: 44 ARLESPGDPLVLERPPP 60 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 92 VLSNSCSPGDPLVLERPPP 110 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A +L+ +PGDPLVLERPPP Sbjct: 11 ANILSNSCSPGDPLVLERPPP 31 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 797 NPGDPLVLERPPP 809 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.3 bits (75), Expect = 0.090 Identities = 16/24 (66%), Positives = 19/24 (79%), Gaps = 3/24 (12%) Frame = -1 Query: 65 AVVLAXLVN---PGDPLVLERPPP 3 +V++A L N PGDPLVLERPPP Sbjct: 29 SVIIASLSNSCSPGDPLVLERPPP 52 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 157 NPGDPLVLERPPP 169 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 12 VLSNSCSPGDPLVLERPPP 30 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 15 VLSNSCSPGDPLVLERPPP 33 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 +W + L+ +PGDPLVLERPPP Sbjct: 46 EW-IFLSNSCSPGDPLVLERPPP 67 >SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) Length = 487 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 66 NPGDPLVLERPPP 78 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 33 VLSNSCSPGDPLVLERPPP 51 >SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 2 VLSNSCSPGDPLVLERPPP 20 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 D A+ + +PGDPLVLERPPP Sbjct: 18 DLALTTSNSCSPGDPLVLERPPP 40 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.090 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 ++++ +PGDPLVLERPPP Sbjct: 13 IIISNSCSPGDPLVLERPPP 32 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 23 VLSNSCSPGDPLVLERPPP 41 >SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L + +PGDPLVLERPPP Sbjct: 317 LLRVIASPGDPLVLERPPP 335 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 19 VLSNSCSPGDPLVLERPPP 37 >SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 90 NPGDPLVLERPPP 102 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 VL+ +PGDPLVLERPPP Sbjct: 13 VLSNSCSPGDPLVLERPPP 31 >SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10) Length = 1292 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 V L +PGDPLVLERPPP Sbjct: 1168 VWTVLTSPGDPLVLERPPP 1186 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A V++ +PGDPLVLERPPP Sbjct: 15 APVISNSCSPGDPLVLERPPP 35 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -1 Query: 68 WAV-VLAXLVNPGDPLVLERPPP 3 W+ +L+ +PGDPLVLERPPP Sbjct: 100 WSTFILSNSCSPGDPLVLERPPP 122 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 34.3 bits (75), Expect = 0.090 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 NPGDPLVLERPPP Sbjct: 242 NPGDPLVLERPPP 254 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 VV + +PGDPLVLERPPP Sbjct: 45 VVTSNSCSPGDPLVLERPPP 64 >SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = -1 Query: 176 ILPAASAVSXG*GYRLFGVSFQXXXXXXXXXXXXVDWAVVLAXLVNPGDPLVLERPPP 3 I PA + S FG + + V+W + PGDPLVLERPPP Sbjct: 12 IKPAQNKESIDININPFGYNRKTLAFDNRNINYVVEWPETWPFKIIPGDPLVLERPPP 69 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 55 ILSNSCSPGDPLVLERPPP 73 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V L+ +PGDPLVLERPPP Sbjct: 9 VFLSNSCSPGDPLVLERPPP 28 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 V+PGDPLVLERPPP Sbjct: 41 VSPGDPLVLERPPP 54 >SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 V+PGDPLVLERPPP Sbjct: 46 VSPGDPLVLERPPP 59 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 + V+ + +PGDPLVLERPPP Sbjct: 7 YKVITSNSCSPGDPLVLERPPP 28 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W V + +PGDPLVLERPPP Sbjct: 21 WNVEGSNSCSPGDPLVLERPPP 42 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 12 ILSNSCSPGDPLVLERPPP 30 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.12 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 +++++ +PGDPLVLERPPP Sbjct: 24 SLIISNSCSPGDPLVLERPPP 44 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 V + + +PGDPLVLERPPP Sbjct: 47 VFSYIRSPGDPLVLERPPP 65 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + L+ +PGDPLVLERPPP Sbjct: 13 IFLSNSCSPGDPLVLERPPP 32 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V + +PGDPLVLERPPP Sbjct: 10 IVTSNSCSPGDPLVLERPPP 29 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V + +PGDPLVLERPPP Sbjct: 88 IVTSNSCSPGDPLVLERPPP 107 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+ + +PGDPLVLERPPP Sbjct: 2 VITSNSCSPGDPLVLERPPP 21 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A V++ +PGDPLVLERPPP Sbjct: 3472 ARVVSNSCSPGDPLVLERPPP 3492 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + L+ +PGDPLVLERPPP Sbjct: 33 IFLSNSCSPGDPLVLERPPP 52 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A +++ +PGDPLVLERPPP Sbjct: 11 ANIISNSCSPGDPLVLERPPP 31 >SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) Length = 362 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 V + L+ PGDPLVLERPPP Sbjct: 58 VQSLLLCPGDPLVLERPPP 76 >SB_47449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 V PGDPLVLERPPP Sbjct: 33 VGPGDPLVLERPPP 46 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 V++ +PGDPLVLERPPP Sbjct: 5 VISNSCSPGDPLVLERPPP 23 >SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 ++PGDPLVLERPPP Sbjct: 167 IDPGDPLVLERPPP 180 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A +++ +PGDPLVLERPPP Sbjct: 11 ANIISNSCSPGDPLVLERPPP 31 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V + +PGDPLVLERPPP Sbjct: 11 IVASNSCSPGDPLVLERPPP 30 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 VV + +PGDPLVLERPPP Sbjct: 3 VVRSNSCSPGDPLVLERPPP 22 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W + +PGDPLVLERPPP Sbjct: 74 WGEGTSNSCSPGDPLVLERPPP 95 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 L +PGDPLVLERPPP Sbjct: 366 LSSPGDPLVLERPPP 380 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 17 IISNSCSPGDPLVLERPPP 35 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 L +PGDPLVLERPPP Sbjct: 45 LKSPGDPLVLERPPP 59 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 62 LLSNSCSPGDPLVLERPPP 80 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 L +PGDPLVLERPPP Sbjct: 431 LSSPGDPLVLERPPP 445 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 119 IISNSCSPGDPLVLERPPP 137 >SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + L + PGDPLVLERPPP Sbjct: 78 ICLQYSLGPGDPLVLERPPP 97 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + ++ +PGDPLVLERPPP Sbjct: 7 ITISNSCSPGDPLVLERPPP 26 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + L+ +PGDPLVLERPPP Sbjct: 15 IPLSNSCSPGDPLVLERPPP 34 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 LA +PGDPLVLERPPP Sbjct: 57 LARSHSPGDPLVLERPPP 74 >SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) Length = 638 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 AXLVNPGDPLVLERPPP 3 A + +PGDPLVLERPPP Sbjct: 23 ATIRSPGDPLVLERPPP 39 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 ++++ +PGDPLVLERPPP Sbjct: 8 ILVSNSCSPGDPLVLERPPP 27 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+ + +PGDPLVLERPPP Sbjct: 185 VIQSNSCSPGDPLVLERPPP 204 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 54 LLSNSCSPGDPLVLERPPP 72 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 2 LLSNSCSPGDPLVLERPPP 20 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 WA + + +PGDPLVLERPPP Sbjct: 15 WASI-SNSCSPGDPLVLERPPP 35 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 65 MLSNSCSPGDPLVLERPPP 83 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 V++ +PGDPLVLERPPP Sbjct: 19 VVSNSCSPGDPLVLERPPP 37 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A L+ +PGDPLVLERPPP Sbjct: 58 AFELSNSCSPGDPLVLERPPP 78 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 ++ + +PGDPLVLERPPP Sbjct: 24 IITSNSCSPGDPLVLERPPP 43 >SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 + PGDPLVLERPPP Sbjct: 100 ITPGDPLVLERPPP 113 >SB_25775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V++ + PGDPLVLERPPP Sbjct: 116 VMMMVNMRPGDPLVLERPPP 135 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 + + L+ +PGDPLVLERPPP Sbjct: 167 YELFLSNSCSPGDPLVLERPPP 188 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A +++ +PGDPLVLERPPP Sbjct: 11 ANIVSNSCSPGDPLVLERPPP 31 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 W+V + +PGDPLVLERPPP Sbjct: 5 WSVT-SNSCSPGDPLVLERPPP 25 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 1 LLSNSCSPGDPLVLERPPP 19 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 4 IISNSCSPGDPLVLERPPP 22 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V ++ +PGDPLVLERPPP Sbjct: 8 VTVSNSCSPGDPLVLERPPP 27 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +L+ +PGDPLVLERPPP Sbjct: 7 LLSNSCSPGDPLVLERPPP 25 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 V++ +PGDPLVLERPPP Sbjct: 27 VVSNSCSPGDPLVLERPPP 45 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + L+ +PGDPLVLERPPP Sbjct: 16 LALSNSCSPGDPLVLERPPP 35 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 34 LSNSCSPGDPLVLERPPP 51 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 ++PGDPLVLERPPP Sbjct: 11 LSPGDPLVLERPPP 24 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 347 IVSNSCSPGDPLVLERPPP 365 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 515 LSNSCSPGDPLVLERPPP 532 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 162 LSNSCSPGDPLVLERPPP 179 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V + +PGDPLVLERPPP Sbjct: 890 LVTSNSCSPGDPLVLERPPP 909 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 64 LSNSCSPGDPLVLERPPP 81 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 62 LSNSCSPGDPLVLERPPP 79 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 ++PGDPLVLERPPP Sbjct: 83 LSPGDPLVLERPPP 96 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 23 LSNSCSPGDPLVLERPPP 40 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 8 LSNSCSPGDPLVLERPPP 25 >SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 D V +PGDPLVLERPPP Sbjct: 284 DKKVQYTSAAHPGDPLVLERPPP 306 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 8 LSNSCSPGDPLVLERPPP 25 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 7 LSNSCSPGDPLVLERPPP 24 >SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 D+ ++ +PGDPLVLERPPP Sbjct: 47 DYVNDISNSCSPGDPLVLERPPP 69 >SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) Length = 386 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 ++PGDPLVLERPPP Sbjct: 266 LSPGDPLVLERPPP 279 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 11 LSNSCSPGDPLVLERPPP 28 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 77 IVSNSCSPGDPLVLERPPP 95 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 AV + +PGDPLVLERPPP Sbjct: 11 AVSSSNSCSPGDPLVLERPPP 31 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 4 LSNSCSPGDPLVLERPPP 21 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 78 LSNSCSPGDPLVLERPPP 95 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 12 LSNSCSPGDPLVLERPPP 29 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 11 LSNSCSPGDPLVLERPPP 28 >SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 4 LSNSCSPGDPLVLERPPP 21 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 23 LSNSCSPGDPLVLERPPP 40 >SB_50958| Best HMM Match : Hc1 (HMM E-Value=3.7) Length = 363 Score = 32.7 bits (71), Expect = 0.27 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +2 Query: 155 QQKLQAILKRQAEFKAAALHCKKSGDKALALEF*RQ*SSSMFW*LLSKRPP 307 +Q+L +++RQ EFK AAL+ K+ GD LE S+ W +SK PP Sbjct: 137 EQQLNFLVERQKEFKMAALNAKREGD----LE------SARHWLRMSKVPP 177 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = +3 Query: 459 VEEALRQRLA-YFQQQEXXXXXXXXXXXXXYGAHCKQYQXAVRLHAAGKAC-RGRAATPP 632 V +AL+QRL Y + G KQY+ A++ H AGK PP Sbjct: 19 VADALQQRLEKYTEAANKAKEEGNSSKARRMGRIVKQYEDAIKCHKAGKPVDYEELPAPP 78 Query: 633 GYXP 644 G+ P Sbjct: 79 GFAP 82 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 6 LSNSCSPGDPLVLERPPP 23 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 6 LSNSCSPGDPLVLERPPP 23 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 38 LSNSCSPGDPLVLERPPP 55 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 7 LSNSCSPGDPLVLERPPP 24 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V + +PGDPLVLERPPP Sbjct: 13 IVESNSCSPGDPLVLERPPP 32 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+ + +PGDPLVLERPPP Sbjct: 16 VLASNSCSPGDPLVLERPPP 35 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 56 LSNSCSPGDPLVLERPPP 73 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 612 LSNSCSPGDPLVLERPPP 629 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 24 LSNSCSPGDPLVLERPPP 41 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 46 LSNSCSPGDPLVLERPPP 63 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 47 LSNSCSPGDPLVLERPPP 64 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 ++ PGDPLVLERPPP Sbjct: 193 VLRPGDPLVLERPPP 207 >SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 5 LSNSCSPGDPLVLERPPP 22 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 23 LSNSCSPGDPLVLERPPP 40 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 13 LSNSCSPGDPLVLERPPP 30 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 8 LSNSCSPGDPLVLERPPP 25 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 85 LSNSCSPGDPLVLERPPP 102 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 ++ + +PGDPLVLERPPP Sbjct: 13 IISSNSCSPGDPLVLERPPP 32 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+ + +PGDPLVLERPPP Sbjct: 36 VLTSNSCSPGDPLVLERPPP 55 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 15 LSNSCSPGDPLVLERPPP 32 >SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 221 LSNSCSPGDPLVLERPPP 238 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 37 LSNSCSPGDPLVLERPPP 54 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 + ++ +PGDPLVLERPPP Sbjct: 30 IAVSNSCSPGDPLVLERPPP 49 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A+ + +PGDPLVLERPPP Sbjct: 3 AISASNSCSPGDPLVLERPPP 23 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A+ + +PGDPLVLERPPP Sbjct: 36 AIKASNSCSPGDPLVLERPPP 56 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 85 IVSNSCSPGDPLVLERPPP 103 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 +V + +PGDPLVLERPPP Sbjct: 19 LVASNSCSPGDPLVLERPPP 38 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 65 AVVLAXLVNPGDPLVLERPPP 3 A + + +PGDPLVLERPPP Sbjct: 7 AQITSNSCSPGDPLVLERPPP 27 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 63 LSNSCSPGDPLVLERPPP 80 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 VLAXLVNPGDPLVLERPPP 3 +++ +PGDPLVLERPPP Sbjct: 6 IVSNSCSPGDPLVLERPPP 24 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 ++PGDPLVLERPPP Sbjct: 102 LSPGDPLVLERPPP 115 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 DWAVVLAXLVNPGDPLVLERPPP 3 D + + +PGDPLVLERPPP Sbjct: 9 DLVIKTSNSCSPGDPLVLERPPP 31 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 L +PGDPLVLERPPP Sbjct: 661 LNHPGDPLVLERPPP 675 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 520 SPGDPLVLERPPP 532 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 36 LSNSCSPGDPLVLERPPP 53 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 LVNPGDPLVLERPPP 3 L+ PGDPLVLERPPP Sbjct: 178 LLCPGDPLVLERPPP 192 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 33 LSNSCSPGDPLVLERPPP 50 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 68 WAVVLAXLVNPGDPLVLERPPP 3 + +V + +PGDPLVLERPPP Sbjct: 423 YRMVSSNSCSPGDPLVLERPPP 444 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 14 LSNSCSPGDPLVLERPPP 31 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LAXLVNPGDPLVLERPPP 3 L+ +PGDPLVLERPPP Sbjct: 29 LSNSCSPGDPLVLERPPP 46 >SB_2194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -1 Query: 44 VNPGDPLVLERPPP 3 ++PGDPLVLERPPP Sbjct: 17 LHPGDPLVLERPPP 30 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+ + +PGDPLVLERPPP Sbjct: 67 VIESNSCSPGDPLVLERPPP 86 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 VVLAXLVNPGDPLVLERPPP 3 V+ + +PGDPLVLERPPP Sbjct: 3 VLASNSCSPGDPLVLERPPP 22 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 16 SPGDPLVLERPPP 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 14 SPGDPLVLERPPP 26 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 30 SPGDPLVLERPPP 42 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 31 SPGDPLVLERPPP 43 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 188 SPGDPLVLERPPP 200 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 19 SPGDPLVLERPPP 31 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 10 SPGDPLVLERPPP 22 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 17 SPGDPLVLERPPP 29 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 31 SPGDPLVLERPPP 43 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 106 SPGDPLVLERPPP 118 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 35 SPGDPLVLERPPP 47 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 39 SPGDPLVLERPPP 51 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 86 SPGDPLVLERPPP 98 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 386 SPGDPLVLERPPP 398 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 28 SPGDPLVLERPPP 40 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 26 SPGDPLVLERPPP 38 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 35 SPGDPLVLERPPP 47 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 12 SPGDPLVLERPPP 24 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 26 SPGDPLVLERPPP 38 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 23 SPGDPLVLERPPP 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 7 SPGDPLVLERPPP 19 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 56 SPGDPLVLERPPP 68 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 58 SPGDPLVLERPPP 70 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 266 SPGDPLVLERPPP 278 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 29 SPGDPLVLERPPP 41 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 23 SPGDPLVLERPPP 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 17 SPGDPLVLERPPP 29 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 24 SPGDPLVLERPPP 36 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 25 SPGDPLVLERPPP 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 39 SPGDPLVLERPPP 51 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 68 SPGDPLVLERPPP 80 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 635 SPGDPLVLERPPP 647 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 20 SPGDPLVLERPPP 32 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 9 SPGDPLVLERPPP 21 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 17 SPGDPLVLERPPP 29 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 117 SPGDPLVLERPPP 129 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 47 SPGDPLVLERPPP 59 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 19 SPGDPLVLERPPP 31 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 880 SPGDPLVLERPPP 892 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 9 SPGDPLVLERPPP 21 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 24 SPGDPLVLERPPP 36 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 47 SPGDPLVLERPPP 59 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 30 SPGDPLVLERPPP 42 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 43 SPGDPLVLERPPP 55 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 25 SPGDPLVLERPPP 37 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 28 SPGDPLVLERPPP 40 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 45 SPGDPLVLERPPP 57 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 41 NPGDPLVLERPPP 3 +PGDPLVLERPPP Sbjct: 7 SPGDPLVLERPPP 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,687,848 Number of Sequences: 59808 Number of extensions: 357568 Number of successful extensions: 3147 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3145 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -