BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0431 (483 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 4.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 7.3 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.4 bits (48), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 Query: 326 VLLCCSPRRCPGKRFPIVTGWXRSRRRIPFAGA 228 VL+C S RC +P+ R R +I GA Sbjct: 167 VLVCVSLDRCFAVIYPLRVSAARKRGKIMLGGA 199 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.6 bits (46), Expect = 7.3 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = -1 Query: 450 PIVQPXLVKGLSXEQESHQRXFLGRSTAXRS*IGVWRXTTNGSPLLFSTPMS 295 P+ P + GL+ E+ RST+ + T + PL+ PM+ Sbjct: 596 PLKSPSKIPGLARRPENISSESRSRSTSKQRANAKTPETPSDQPLIKEVPMN 647 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 394,048 Number of Sequences: 2352 Number of extensions: 5792 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -