BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0430 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0535 - 11292509-11294679,11294971-11295040,11295268-112953... 29 3.5 05_07_0165 + 28107093-28108457 29 4.6 >02_02_0535 - 11292509-11294679,11294971-11295040,11295268-11295324, 11298629-11298789,11299123-11299156 Length = 830 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 519 QRNQYLTLSVKTTPTQNHMAYGVNS 593 QR Q L+ S +T P NH ++G N+ Sbjct: 790 QRKQLLSFSQRTVPVNNHSSHGSNN 814 >05_07_0165 + 28107093-28108457 Length = 454 Score = 28.7 bits (61), Expect = 4.6 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 3/98 (3%) Frame = +2 Query: 11 TRPDAQKMKTVQVILCLFVASLYANGTSVSDSKLEDDLYNSILVADYDNAVEKSXQIYED 190 T ++ + +V++ + + + S S S + D+Y S Q ED Sbjct: 349 TTATVRRFSSTKVVIMSWDSKICLPVASSSLSSFQWDIYAGYRPTLLSPLTFASGQHEED 408 Query: 191 -KKSEVITNVVNKLIRNNK-MNCRXTPTSSGC-KAPRI 295 K ++ + + +R+ K CR +PTS+GC A RI Sbjct: 409 DNKCDLFIRSLLRTLRSQKSQKCRPSPTSAGCTNAKRI 446 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,896,926 Number of Sequences: 37544 Number of extensions: 216919 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -