BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0427 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 27 0.14 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.3 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 7.1 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 27.5 bits (58), Expect = 0.14 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -2 Query: 684 TNFPTVRSSLSEN-EKIPLPRGSLP-TLVSWVWKACGIHETTYNSIMKC 544 T+ T SS++ N IP G+ P ++++ W AC T +SIMKC Sbjct: 1009 THSATSNSSVNANTNNIPTNAGTTPGAILAFSW-ACNDAVMTSDSIMKC 1056 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 351 LPSNRCGSRNRSTTSLAPPLYTG 283 LP++RC SR S + + P +G Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSG 101 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 2.3 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +2 Query: 596 TQETRVGREPLGNGIFSFSDSDDLTVGKFVRLSPKELLDATGGPFPASKVKXRRKHS 766 T E +V ++ G+G S++LT K + E + +GG + ++K R HS Sbjct: 15 TDEVKVFKDE-GDGEDEKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHS 70 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 371 STDPYGVLPLWRSNDLN 421 + DPYG++ W ++ LN Sbjct: 141 AVDPYGLVAQWATDALN 157 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 686 RLSPKELLDATGGPFPASKVKXRRKHSFSFDCSR 787 +L+ K L GGP P S ++ DC+R Sbjct: 1260 QLAQKYQLPKMGGPQPYSACSENAFAAYPGDCTR 1293 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,335 Number of Sequences: 336 Number of extensions: 4490 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -