BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0427 (865 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 150 1e-38 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 4.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 8.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 8.4 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 150 bits (364), Expect = 1e-38 Identities = 84/126 (66%), Positives = 93/126 (73%), Gaps = 4/126 (3%) Frame = -1 Query: 691 KSYELPDGQVITIGKRKDSVAQRLSSNPRFLGMESLR-HPRDHI*LHH---EVRRGHP*G 524 KSYELPDGQVITIG + + L P FLGME+ H + + ++R+ Sbjct: 13 KSYELPDGQVITIGNERFRCPEALFQ-PSFLGMEACGIHETTYNSIMKCDVDIRKD---- 67 Query: 523 LVRQHVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 344 L VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTF Sbjct: 68 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTF 127 Query: 343 QQMWIS 326 QQMWIS Sbjct: 128 QQMWIS 133 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.6 bits (46), Expect = 4.8 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 730 KWXTGC-IQQFLRRKSYELPDGQVITIGKRKDSV 632 K+ C I ++RRK E + +T+G R + V Sbjct: 224 KYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECV 257 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 509 RIVRWYHHVPWNRRPYAK 456 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 509 RIVRWYHHVPWNRRPYAK 456 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,113 Number of Sequences: 438 Number of extensions: 5789 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -