BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0425 (805 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 25 0.71 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 6.6 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 6.6 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 6.6 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 8.7 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 25.0 bits (52), Expect = 0.71 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 394 YSGARKWTVGGHSGYYALEAALDRAIKEGYDITNPEYY*R 513 YSG K H Y + + IK Y++TN ++Y R Sbjct: 428 YSGPYKIIAKPHPNTYQIADPVTNEIKGVYNMTNLKFYHR 467 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 400 GARKWTVGGHSGYYALEAALDRAIKEGYDITN 495 G+ + GG SGY L + L K D+ N Sbjct: 158 GSSQLGTGGSSGYQYLRSTLSDRYKVFVDLFN 189 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 400 GARKWTVGGHSGYYALEAALDRAIKEGYDITN 495 G+ + GG SGY L + L K D+ N Sbjct: 318 GSSQLGTGGSSGYQYLRSTLSDRYKVFVDLFN 349 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 400 GARKWTVGGHSGYYALEAALDRAIKEGYDITN 495 G+ + GG SGY L + L K D+ N Sbjct: 318 GSSQLGTGGSSGYQYLRSTLSDRYKVFVDLFN 349 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = -2 Query: 219 CLAYLAIYSPDFAGSKTTSSSMVIK 145 CL + +Y+PD G K+ +++ Sbjct: 315 CLRAIILYNPDVRGIKSVQEVEMLR 339 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,985 Number of Sequences: 336 Number of extensions: 4286 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -