BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0425 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 24 4.8 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 24 6.3 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 24.2 bits (50), Expect = 4.8 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = -3 Query: 374 NVSATNTQSTALGCSTLGCIPVPASGISSLLVDIDVSISLMLYLILLHVSVHA 216 N AT+ + ALG +T+ + ++G+ S L I ++ +YL++ V V A Sbjct: 247 NHEATSAR-VALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFA 298 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 220 MLSISSNIFTGFCWQQNNFVIHGYKMIV 137 ++S+SSN TG NN ++ Y+ +V Sbjct: 542 VVSVSSNHITGESVATNNILLQPYEAVV 569 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 844,160 Number of Sequences: 2352 Number of extensions: 18227 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -