BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0418 (876 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 29 0.14 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 27 0.99 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 27 0.99 Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease prot... 23 9.2 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 9.2 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 29.5 bits (63), Expect = 0.14 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 513 LEHYLIGGIGTAHSDGVNEYDSQFRHGYGQGAKCP-SPG-IFRYFF 382 +E++L+G T H G+++ + + G ++CP SPG FRY F Sbjct: 367 VENHLMGESTTIHWHGLHQRRTPYMDGVPHVSQCPISPGTTFRYTF 412 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 26.6 bits (56), Expect = 0.99 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 509 NTI*LVA*EQLIPTA*TNMTPSFDTVMV 426 N++ A LIPTA TN+ PSF T + Sbjct: 824 NSLAAAAAATLIPTATTNVRPSFTTTSI 851 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 26.6 bits (56), Expect = 0.99 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 509 NTI*LVA*EQLIPTA*TNMTPSFDTVMV 426 N++ A LIPTA TN+ PSF T + Sbjct: 823 NSLAAAAAATLIPTATTNVRPSFTTTSI 850 >Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease protein. Length = 268 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 513 SISGIHVIMFSFMPESPNYLLK 578 +ISG FSF P PN L+K Sbjct: 157 TISGWGSTSFSFEPSYPNILMK 178 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -2 Query: 401 ASSDISLTYTGTATKQ-PPDAIPAMTL 324 A++ ++T T T K PP+AIPA+++ Sbjct: 279 AATAAAMTTTTTTKKSTPPNAIPALSV 305 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 932,031 Number of Sequences: 2352 Number of extensions: 19358 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -