BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0416 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_1872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) 28 5.9 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 228 RSPTRKVLSIGWDMDTTGRRLIDEICQIAAYTP 326 R+P+R ++ GWD +T + DE C + P Sbjct: 1024 RAPSRNIIGGGWDESSTWKDAFDEPCSTPSRLP 1056 >SB_1872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1801 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 66 HDECFKVILLL*NITXSQHXCG 1 HD+ FKV L+L + +QH CG Sbjct: 1511 HDQLFKVFLVLLDFRVTQHQCG 1532 >SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) Length = 1021 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +1 Query: 52 KTFVVHHTGLRGSYFVYQHLFINEFAN*ALMAMVTEVKV----NGSEMEANTEVPPALAE 219 K F++H + RG + V+Q++ IN LMA +T + N S+ + +EV L + Sbjct: 857 KEFILHASKRRGDFPVFQNVPINTKEGGVLMATITGSEALRIENQSDEDTRSEVMATLRQ 916 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,018,710 Number of Sequences: 59808 Number of extensions: 352722 Number of successful extensions: 787 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -