BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0416 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.0 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 23 2.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.9 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +2 Query: 50 LKHSSCIIPVYAAHILFTNICSSTSLQI 133 L +S ++P+ A ++LFT I ++ S+ + Sbjct: 286 LPPTSLVLPLIAKYLLFTFIMNTVSILV 313 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 248 YFPGGRPTGFSASAGGTSVFAS 183 +FPGG+ T F S G + A+ Sbjct: 244 FFPGGKKTTFFESCGVADLIAT 265 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = +3 Query: 243 KVLSIGWDMDTTGRRLIDEICQIAAYTPKQTYSQYIMPYGDLN 371 K++ ++ +TT + + ++C YT Q + + + DL+ Sbjct: 557 KLVQAAFEQNTTDQSMDIDVCDNQTYTSLQMAMKNPIEFTDLS 599 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 157 QSPWPLMPNL 128 QSP+PL PNL Sbjct: 650 QSPFPLPPNL 659 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,049 Number of Sequences: 438 Number of extensions: 3155 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -