BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0415 (371 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ... 63 1e-09 UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;... 42 0.005 UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|... 36 0.23 UniRef50_Q5DDG7 Cluster: SJCHGC07011 protein; n=1; Schistosoma j... 35 0.41 UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ... 33 1.7 UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar p... 32 2.9 >UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes scapularis|Rep: Putative secreted protein - Ixodes scapularis (Black-legged tick) (Deer tick) Length = 65 Score = 63.3 bits (147), Expect = 1e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = +1 Query: 37 PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 195 P G+TANGS+ Q WFLRS+ TWITV ILELIHA+ AFIR + I Sbjct: 2 PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54 >UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 508 Score = 41.5 bits (93), Expect = 0.005 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +3 Query: 102 YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 194 YLDNCGNSRANTC + D C Y KTN Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497 >UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|Rep: Novel protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 118 Score = 35.9 bits (79), Expect = 0.23 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 288 MSALSTFDGSFCDYHG 335 MSALSTFDG+FC YHG Sbjct: 1 MSALSTFDGTFCAYHG 16 >UniRef50_Q5DDG7 Cluster: SJCHGC07011 protein; n=1; Schistosoma japonicum|Rep: SJCHGC07011 protein - Schistosoma japonicum (Blood fluke) Length = 101 Score = 35.1 bits (77), Expect = 0.41 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 105 LDNCGNSRANTCNQNSDQ*WDECFY*IKTNRRRASRPKSLILMNLDNFCRRMVKYR 272 +DNC NSRANTC ++ + F +TNR + + ++D C ++ R Sbjct: 1 MDNCSNSRANTCLESLTRKGTGAFIRTETNRVQRLMTSVPVTSSVDELCDNVILSR 56 >UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; Roseovarius sp. HTCC2601|Rep: Putative uncharacterized protein - Roseovarius sp. HTCC2601 Length = 507 Score = 33.1 bits (72), Expect = 1.7 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 94 YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 213 YS T + VV+ EL+ T+ SD +A I + P+DG R+ Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178 >UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar protein sorting protein 36 (ELL-associated protein of 45 kDa), partial; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Vacuolar protein sorting protein 36 (ELL-associated protein of 45 kDa), partial - Strongylocentrotus purpuratus Length = 349 Score = 32.3 bits (70), Expect = 2.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 351 PVTRDNHGSRRNYHRKLIRQTFERCVA 271 PVTR+ HGS YH +L +Q E +A Sbjct: 190 PVTRETHGSGLKYHEELAKQLSEALIA 216 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,323,827 Number of Sequences: 1657284 Number of extensions: 6354095 Number of successful extensions: 12875 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12872 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 13594373344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -