BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0415 (371 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 2.1 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 4.9 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 4.9 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 4.9 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 22 6.4 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 22 8.5 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.8 bits (49), Expect = 2.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 245 LLQTHGQVPATHLSNVCLINF 307 LLQ GQ+PAT +NV + F Sbjct: 475 LLQVFGQIPATQ-TNVAIATF 494 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 290 HLKDASPVLDHASAK 246 HLKDASP L + K Sbjct: 449 HLKDASPFLQERAVK 463 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 22.2 bits (45), Expect = 6.4 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = -2 Query: 352 PRYP*QPW*SQKLPSKVDKADI*KMRRRYLTMRLQKLSRFIKINDFGREALRR 194 P P P S++LP ++ + RR Y+ ++ ++ R ++ D + RR Sbjct: 1104 PPVPPIPPRSRRLPPSPRTTEMRRRRRNYMQLQYRRRRRDGELGDVPQGRQRR 1156 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 21.8 bits (44), Expect = 8.5 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 206 GPPSIGFDLIKALIPSLVRVLIACISSRITTVIQVTE*DLRNQN*YIE 63 G IG D + S +L++ +S+ T ++ LRN++ YI+ Sbjct: 418 GDLGIGADSCRRESESSDSILLSPEASKATEAVEFIAEHLRNEDLYIQ 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 387,940 Number of Sequences: 2352 Number of extensions: 7637 Number of successful extensions: 21 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28374390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -