BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0415 (371 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 2.4 Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical pr... 27 3.2 Z79752-4|CAB02083.1| 1188|Caenorhabditis elegans Hypothetical pr... 27 5.7 AL032623-17|CAN86638.1| 1398|Caenorhabditis elegans Hypothetical... 26 7.5 AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical... 26 7.5 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 49 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 153 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 >Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical protein C34C6.3 protein. Length = 520 Score = 27.5 bits (58), Expect = 3.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 91 SYSVTWITVVILELIHAIRTLTSDGMS 171 SY+V+WIT + IR + SDG++ Sbjct: 54 SYNVSWITPAASNSTYRIRLIDSDGLT 80 >Z79752-4|CAB02083.1| 1188|Caenorhabditis elegans Hypothetical protein D2005.4 protein. Length = 1188 Score = 26.6 bits (56), Expect = 5.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 76 TDILSHSRYRLNTACTETC 20 T++L H+R+ L AC E C Sbjct: 245 TEVLKHARFCLGLACCERC 263 >AL032623-17|CAN86638.1| 1398|Caenorhabditis elegans Hypothetical protein Y43F8B.3b protein. Length = 1398 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 312 HRKLIRQTFERCVAG-T*PCVCKSYPDSSKLTTSDARPSVDWF 187 H L+ ++ C T P C+ P+S +T + A P+ W+ Sbjct: 670 HLGLVPDEYQCCPGSPTNPGACQGLPESEGVTGAPAPPTSRWY 712 >AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical protein Y43F8B.3a protein. Length = 1816 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 312 HRKLIRQTFERCVAG-T*PCVCKSYPDSSKLTTSDARPSVDWF 187 H L+ ++ C T P C+ P+S +T + A P+ W+ Sbjct: 1088 HLGLVPDEYQCCPGSPTNPGACQGLPESEGVTGAPAPPTSRWY 1130 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,287,295 Number of Sequences: 27780 Number of extensions: 149379 Number of successful extensions: 351 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 535612900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -