BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0415 (371 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 0.43 At4g38560.1 68417.m05459 expressed protein 27 5.3 At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putati... 27 5.3 At5g49310.1 68418.m06102 importin alpha-1 subunit, putative simi... 26 7.0 At1g77600.1 68414.m09035 expressed protein weak similarity to Pd... 26 7.0 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 0.43 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 237 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 142 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 26.6 bits (56), Expect = 5.3 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 46 GDTANGSIYQFWFLRSYSVTWITVVILEL 132 GD A+GS Q +SYS+ + V+LEL Sbjct: 360 GDIASGSKLQSLRTKSYSLETLAAVVLEL 388 >At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putative (PAUSED) contains Pfam profile: PF04150 exportin-t, identical to PAUSED gi:30909318 Length = 988 Score = 26.6 bits (56), Expect = 5.3 Identities = 13/57 (22%), Positives = 30/57 (52%) Frame = -1 Query: 275 SPVLDHASAKVIQIHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACISSRITTVIQ 105 S +L + +V++ H+ RL + ++ DL+ ++PS+ V+ C +++Q Sbjct: 301 SALLTGYAVEVLECHK--RLNSEDTKAVSMDLLNEVLPSVFYVMQKCEVDSTFSIVQ 355 >At5g49310.1 68418.m06102 importin alpha-1 subunit, putative similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 519 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 209 RGPPSIGFDLIKALIPSLVRVL 144 RG PS FDL+K ++P L R++ Sbjct: 228 RGKPSPPFDLVKHVLPVLKRLV 249 >At1g77600.1 68414.m09035 expressed protein weak similarity to Pds5 (GI:16751524) [Schizosaccharomyces pombe]; weak similarity to androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 1285 Score = 26.2 bits (55), Expect = 7.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 228 LMNLDNFCRRMVKYRRRIFQMSALSTFDGSFCDYHG 335 ++ DN + Y R+FQ+ L T SF HG Sbjct: 773 VLEYDNIYEDITSYIYRVFQIYGLKTLVKSFLPRHG 808 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,942,188 Number of Sequences: 28952 Number of extensions: 142686 Number of successful extensions: 295 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -