Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0414
         (356 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB013287-1|BAA87893.1|  190|Apis mellifera calmodulin kinase II ...    22   1.9  
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          21   3.3  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      21   3.3  

>AB013287-1|BAA87893.1|  190|Apis mellifera calmodulin kinase II
           protein.
          Length = 190

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 11/37 (29%), Positives = 18/37 (48%)
 Frame = +1

Query: 79  FPSPNWFQVSGLAISKDGWLVYSGPGKSLCIVEPLKN 189
           +PSP W  V+  A +    ++   P K +   E LK+
Sbjct: 131 YPSPEWDTVTPEAKNLINQMLTVNPSKRITASEALKH 167


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 3.3
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 38  YIVNNK*KWMNQY 76
           YI+NN  KW N Y
Sbjct: 342 YILNNDGKWHNIY 354


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 3.3
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 38  YIVNNK*KWMNQY 76
           YI+NN  KW N Y
Sbjct: 342 YILNNDGKWHNIY 354


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,282
Number of Sequences: 438
Number of extensions: 2197
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8308335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)