BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0414 (356 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 22 1.9 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 3.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 3.3 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 22.2 bits (45), Expect = 1.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 79 FPSPNWFQVSGLAISKDGWLVYSGPGKSLCIVEPLKN 189 +PSP W V+ A + ++ P K + E LK+ Sbjct: 131 YPSPEWDTVTPEAKNLINQMLTVNPSKRITASEALKH 167 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 3.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 38 YIVNNK*KWMNQY 76 YI+NN KW N Y Sbjct: 342 YILNNDGKWHNIY 354 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 3.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 38 YIVNNK*KWMNQY 76 YI+NN KW N Y Sbjct: 342 YILNNDGKWHNIY 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,282 Number of Sequences: 438 Number of extensions: 2197 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8308335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -