BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0412 (664 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizo... 27 3.2 SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizos... 26 4.2 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 25 9.7 >SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1000 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 151 RASAPKGGRAALPAAPEIIQNQTRWGERRSPLSVNNAI 38 R A + GR AL + + +N TR+ +P+SV ++I Sbjct: 104 RRPAGRRGRPALNTSNSLERNGTRYVSAEAPISVKSSI 141 >SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = -3 Query: 443 CNKIYL*IGLNITIQKTLVFYCHYMNIQKLPKTESEHPTFHMVLSAL 303 C +++L G I + + L+FY + + K ++E+P +H LSAL Sbjct: 17 CLRLFL-FGSLILLLRPLIFYSN----TTMKKLKTEYPIYHRHLSAL 58 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 5 WRYPWLMLFG*NSIIY*KWGPSFSPSC-LVLNYLRRCGKSSPSAFGC 142 W + W M+ + IY W + L+L Y+R KSS + F C Sbjct: 192 WAFDWPMMNLQETFIY--WDRCTNACLRLLLCYIRYTNKSSETGFSC 236 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,655,162 Number of Sequences: 5004 Number of extensions: 52923 Number of successful extensions: 122 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -