BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0412 (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169,588... 31 1.1 >06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169, 5882267-5882336,5882639-5882724,5882916-5883017, 5883375-5883597,5883693-5883758,5883896-5883986, 5884019-5884057,5885401-5885548,5885623-5885715, 5885782-5885886,5886645-5886826,5886912-5887084 Length = 566 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 245 HTGQGRSHSAPPVFIYTLGVGQTRPCGKLDALIQFWVIFGYSCSD 379 H QG S PP+ + T G G LD +Q+W G++ D Sbjct: 356 HIFQGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWAFVD 400 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,384,452 Number of Sequences: 37544 Number of extensions: 357097 Number of successful extensions: 942 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -