BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0412 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 27 0.12 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.4 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 4.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.5 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 4.5 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 22 6.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 6.0 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 27.5 bits (58), Expect = 0.12 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 180 GWLVAFSIQPHLLYLVWYPH 239 G+L+A +QP L++ +W PH Sbjct: 162 GFLLAGIVQPFLIHWIWTPH 181 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 443 CNKIYL*IGLNITIQKTLVFY 381 C++ YL I NIT+++ +FY Sbjct: 227 CDEPYLDITFNITMRRKTLFY 247 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 443 CNKIYL*IGLNITIQKTLVFY 381 C++ YL I NIT+++ +FY Sbjct: 227 CDEPYLDITFNITMRRKTLFY 247 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 443 CNKIYL*IGLNITIQKTLVFY 381 C++ YL I NIT+++ +FY Sbjct: 223 CDEPYLDITFNITMRRKTLFY 243 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 198 SIQPHLLYLVWY 233 S+ P +LYL WY Sbjct: 803 SVIPRILYLTWY 814 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +3 Query: 198 SIQPHLLYLVWYPHSVTLGR 257 +I+P+ Y +W+P + G+ Sbjct: 138 NIEPYNNYYIWHPGKIVNGK 157 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = +1 Query: 148 HGQLMTSSEVSAGWSHSASSLICSTSYGTHTLSH 249 HG L SH L+C +Y + SH Sbjct: 1445 HGNLDELQLSRHATSHELKGLLCGNTYQLYLTSH 1478 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = +1 Query: 148 HGQLMTSSEVSAGWSHSASSLICSTSYGTHTLSH 249 HG L SH L+C +Y + SH Sbjct: 1441 HGNLDELQLSRHATSHELKGLLCGNTYQLYLTSH 1474 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +3 Query: 198 SIQPHLLYLVWYPHSVTLGR 257 +I+P+ Y +W+P + G+ Sbjct: 138 NIEPYNNYYIWHPGKIVNGK 157 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 448 LNAIKSIYKLD*I*QYKKLSCF 383 L+ +KS+Y+ + Q KKL CF Sbjct: 34 LSDLKSMYESNSEEQMKKLGCF 55 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -1 Query: 133 GGRAALPAAPEIIQNQTRWGERRSPLS 53 GG P I+ ++ W ER P+S Sbjct: 58 GGVQVSPVQENIVIDKRPWWERYQPIS 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,821 Number of Sequences: 438 Number of extensions: 3755 Number of successful extensions: 20 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -