BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0410 (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0038 + 11790075-11790302,11790397-11790542,11790915-117910... 29 3.5 10_08_0379 - 17373533-17374147 28 8.1 >09_03_0038 + 11790075-11790302,11790397-11790542,11790915-11791017, 11791148-11791334,11791466-11791559,11791702-11791855, 11792189-11792305,11792695-11792808,11793629-11793811, 11794209-11794494,11794592-11794713,11794746-11794802, 11794803-11794900,11795036-11795213,11795355-11795455, 11795530-11795629,11795751-11795828,11796785-11796862, 11796956-11797138 Length = 868 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -2 Query: 288 VASFCHTIYGFRQLNDYNLLKSLNVDIWMSLDDSI 184 ++S H +Y FR DY++L +N DI + + + + Sbjct: 554 LSSLLHLLYAFRDEADYSVLSHINSDIQLFVGNDL 588 >10_08_0379 - 17373533-17374147 Length = 204 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 59 KHTGRSVFSSYQKKKKYIPPFPKSA 133 +H R+ SY+KKK+ PP P SA Sbjct: 153 EHQARARGVSYEKKKRKKPPHPSSA 177 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,927,437 Number of Sequences: 37544 Number of extensions: 290719 Number of successful extensions: 491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -