BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0410 (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81109-11|CAB03254.2| 318|Caenorhabditis elegans Hypothetical p... 28 7.3 Z81136-1|CAB03458.1| 1256|Caenorhabditis elegans Hypothetical pr... 27 9.7 >Z81109-11|CAB03254.2| 318|Caenorhabditis elegans Hypothetical protein R10D12.11 protein. Length = 318 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 Query: 306 SAVVNKVASFCHTIYGFRQLNDYNLLKSLNVDIWMSLDDSII 181 S VN +A FC T + Y LNV IW+ L D I+ Sbjct: 19 SVPVNLLAIFCITTQSSNTMKQYKWYL-LNVQIWIFLTDIIL 59 >Z81136-1|CAB03458.1| 1256|Caenorhabditis elegans Hypothetical protein W02B8.2 protein. Length = 1256 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 522 KDYSVVPVSCRLCF-KITNFTXINKGS 599 + YSV+ + C LCF IT FT NK S Sbjct: 747 RHYSVLSMKCSLCFVGITFFTKANKCS 773 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,630,813 Number of Sequences: 27780 Number of extensions: 285314 Number of successful extensions: 544 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 544 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -