BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0408 (770 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1019| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36481| Best HMM Match : DUF922 (HMM E-Value=1.8) 29 5.5 >SB_1019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +2 Query: 305 SGPLEKFRKRASFDWRRMKFIYDNFNTI-KLKHEFYTFMENHTLFHHSDVT-PSLDEQRH 478 +GPL+ FRK+A+FD R M++ D I + K F+ M LF H S D + Sbjct: 16 NGPLDVFRKQATFDVREMRYFVDGGQDITEFKGNFWKRMGKVPLFSHEKTKGASFDGKGR 75 Query: 479 XATKRMYAIY 508 A +R+ +Y Sbjct: 76 LAFRRVRRVY 85 >SB_36481| Best HMM Match : DUF922 (HMM E-Value=1.8) Length = 1150 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 449 VTPSLDEQRHXATKRMYAIYMKIFYHLK 532 ++P+L E+RH +++ A +K+F+ LK Sbjct: 1047 LSPALREERHEEARKVAAFMIKVFWSLK 1074 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,411,914 Number of Sequences: 59808 Number of extensions: 489335 Number of successful extensions: 926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -