BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0408 (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor... 24 4.5 AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor... 24 4.5 AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor... 24 4.5 AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor... 24 4.5 AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor... 24 4.5 AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor... 24 4.5 AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor... 24 4.5 AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor... 24 4.5 AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor... 24 4.5 AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor... 24 4.5 AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor... 24 4.5 AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor... 24 4.5 AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor... 24 4.5 AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor... 24 4.5 AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor... 24 4.5 AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor... 24 4.5 AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor... 24 4.5 AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor... 24 4.5 AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor... 24 4.5 AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor... 24 4.5 AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor... 24 4.5 AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor... 24 4.5 AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor... 24 6.0 >AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 20 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 52 >AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 20 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 52 >AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 14 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 46 >AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 14 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 46 >AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 20 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 52 >AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 20 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 52 >AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 19 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 51 >AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 19 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 51 >AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 11 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 43 >AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 11 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTAL 43 >AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 54 >AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 25 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 57 >AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 25 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 57 >AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTAL 55 >AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 55 >AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 23 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTAL 55 >AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 17 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 49 >AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 17 VFEQNKNRTAGETVLLKQTGYILWFFFRFVTTL 49 >AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 323 IFPKDRTANPGSTVLVHHQKALCIFFFHFPTKI 225 +F +++ G TVL+ + FFF F T + Sbjct: 22 VFEQNQNRTAGETVLLKQTGYILWFFFRFVTTL 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 809,625 Number of Sequences: 2352 Number of extensions: 17386 Number of successful extensions: 68 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -