BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0408 (770 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y11411-1|CAA72214.1| 700|Homo sapiens pristanoyl-CoA oxidase pr... 45 3e-04 BC017053-1|AAH17053.1| 624|Homo sapiens ACOX3 protein protein. 45 3e-04 >Y11411-1|CAA72214.1| 700|Homo sapiens pristanoyl-CoA oxidase protein. Length = 700 Score = 44.8 bits (101), Expect = 3e-04 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +2 Query: 293 PDLPSGPLEKFRKRASFDWRRMKFIYDNFNTIKLKHEFYTFMENHTLFHHS-DVTPSLDE 469 P+ P GPL+ +R RASF W+ + + ++ K ++ +EN LF S SL++ Sbjct: 14 PEFPRGPLDAYRARASFSWKDVALFTEGEGNVRFKKTIFSALENDPLFARSPGADLSLEK 73 Query: 470 QRHXATKRMYAIYMKIFYHLKR*LQXP 550 R R I+ F ++ + P Sbjct: 74 YRELNFLRCKRIFEYDFLSVEAMFKSP 100 >BC017053-1|AAH17053.1| 624|Homo sapiens ACOX3 protein protein. Length = 624 Score = 44.8 bits (101), Expect = 3e-04 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +2 Query: 293 PDLPSGPLEKFRKRASFDWRRMKFIYDNFNTIKLKHEFYTFMENHTLFHHS 445 P+ P GPL+ +R RASF W+ + + ++ K ++ +EN LF S Sbjct: 14 PEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARS 64 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,649,750 Number of Sequences: 237096 Number of extensions: 2427511 Number of successful extensions: 4455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4455 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9311505506 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -