BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0406 (839 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 24 6.6 Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium... 23 8.7 DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium c... 23 8.7 DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodi... 23 8.7 DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodi... 23 8.7 AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel pro... 23 8.7 AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel pro... 23 8.7 AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel pro... 23 8.7 AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel pro... 23 8.7 AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel pro... 23 8.7 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.7 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.8 bits (49), Expect = 6.6 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 487 MKILSHREHGDXRTFKLNHRRCQLYGNTTICTRRLLFL 374 +KI +++E + +NH +Y T +CT R+ F+ Sbjct: 389 LKIFNNQEFAQLLSQSVNHGFEAVYELTKMCTIRMSFV 426 >Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium channel protein. Length = 136 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 62 MHSFMIVFRVLCGEWIESMWDCML 85 >DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium channel variant 1 protein. Length = 78 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 16 MHSFMIVFRVLCGEWIESMWDCML 39 >DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 10 MHSFMIVFRVLCGEWIESMWDCML 33 >DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 10 MHSFMIVFRVLCGEWIESMWDCML 33 >AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 19 MHSFMIVFRVLCGEWIESMWDCML 42 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 639 IHNFNT*F*LLCGCLTEGVWCCKI 710 +H+F F +LCG E +W C + Sbjct: 977 MHSFMIVFRVLCGEWIESMWDCML 1000 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,330 Number of Sequences: 2352 Number of extensions: 11998 Number of successful extensions: 39 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -