BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0400 (580 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 31 0.68 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 29 2.1 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 29 3.6 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 6.3 SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) 28 6.3 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 160 DVVAVSQAPSPESNPDSPLPVTTM 89 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 151 AVSQAPSPESNPDSPLPVTTM 89 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +3 Query: 270 LNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGXP 410 ++++ R +WRASL Y K+VAVKKLVV F VG P Sbjct: 56 MHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = +3 Query: 285 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGXP 410 R +WRASL Y K+VAVKKLVV F VG P Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.042 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 150 PFLRLPLRNRTLIPRYP 100 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.51 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +3 Query: 297 RASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGXP 410 RASL Y K+VAVKKLVV F VG P Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 736 Score = 31.1 bits (67), Expect = 0.68 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -3 Query: 212 LPAPCREWVICAPAA-FLGCGSRFSGSLSGIEP*FPVTRDNHGSRRNYHRKLIRQTFERC 36 L PCR + C+PA C RF G ++G P+ +G RR +H L+ F C Sbjct: 127 LEKPCRNFGTCSPAPNDYNCTCRFDGLVTGKNCDVPLIMLYYGQRR-HHGCLV--CFRLC 183 Query: 35 VAGT 24 V+ + Sbjct: 184 VSSS 187 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 285 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGXP 410 R ASL Y K+VAVKKLVV F VG P Sbjct: 24 RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 345 YTKIVAVKKLVVAFVRRAVGXP 410 Y K+VAVKKLVV F VG P Sbjct: 88 YIKVVAVKKLVVGFRDGTVGPP 109 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 345 YTKIVAVKKLVVAFVRRAVGXP 410 Y K+VAVKKLVV F VG P Sbjct: 89 YIKVVAVKKLVVGFRDGTVGPP 110 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 345 YTKIVAVKKLVVAFVRRAVGXP 410 Y K+VAVKKLVV F VG P Sbjct: 17 YIKVVAVKKLVVGFRDGTVGPP 38 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 383 CNYELFNRNNFSIRYWSWNYRGCWH 309 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 169 PSLDVVAVSQAPSPESNPDSPLP 101 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) Length = 591 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 455 AGVSKKRRFNIKILSRCSRLVXKWGRQIL 541 AGV KK+R N+ + S C R+V + + +L Sbjct: 149 AGVHKKKRMNLLVTSDCIRVVDEETKVVL 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,914,647 Number of Sequences: 59808 Number of extensions: 339124 Number of successful extensions: 858 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -