BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0400 (580 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 7.2 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 7.2 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.0 bits (47), Expect = 7.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 112 NQGSIPEREPEKRLPHPRKAAGAQITHS-RHGAGS 213 N GS PE P + + +K + + HS G+GS Sbjct: 103 NNGSFPELPPMRGKTYSKKLSFEYLQHSVTSGSGS 137 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.0 bits (47), Expect = 7.2 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -1 Query: 205 PRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 62 P A S A +P LDV+ AP P + D P VT E+ +ES Sbjct: 283 PAATSAPLAFKVP-LDVLP---APFPGPSTDEPRTVTRKRTTESDVES 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,591 Number of Sequences: 2352 Number of extensions: 12022 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -